Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.83
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Infertility 163 4.206 2.1

Expression

Synonym

Accession Q9BXU0 A6NDL9 B0YIX3
Symbols

Gene

Gene RIF (2)

PMID Text
22870393 a model of chromosome synapsis driven by growth of SYCE2-TEX12 higher-order structures within the CE of the SC.
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMANHLVKPDNRNCKRPRELESPVPDSPQLSSLGKSDSSFSEISGLFYKDEALEKDLNDVSKEINLMLST      1 - 70
YAKLLSERAAVDASYIDEIDELFKEANAIENFLIQKREFLRQRFTVIANTLHR                      71 - 123
//

Text Mined References (9)

PMID Year Title
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
22870393 2012 Structural analysis of the human SYCE2-TEX12 complex provides molecular insights into synaptonemal complex assembly.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.