Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.83
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Infertility 188 4.192 2.1

Expression

Gene RIF (2)

AA Sequence

MMANHLVKPDNRNCKRPRELESPVPDSPQLSSLGKSDSSFSEISGLFYKDEALEKDLNDVSKEINLMLST      1 - 70
YAKLLSERAAVDASYIDEIDELFKEANAIENFLIQKREFLRQRFTVIANTLHR                      71 - 123
//

Text Mined References (9)

PMID Year Title