Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 2.28

Knowledge Summary

Patent (613)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 3.780 0.000
atypical teratoid / rhabdoid tumor 1.100 0.008
medulloblastoma, large-cell 1.400 0.000
adult high grade glioma 1.200 0.002
ovarian cancer 1.400 0.000

Synonym

Accession Q9BXT2
Symbols

Gene

 MGI Term (1)

Gene RIF (2)

PMID Text
20860846 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20860846 CACNG6 variants might be associated with the risk of aspirin-intolerant asthma in a Korean population.

AA Sequence

MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKA      1 - 70
NGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLA     71 - 140
AAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPA    141 - 210
PRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT                        211 - 260
//

Text Mined References (6)

PMID Year Title
20860846 2010 Association of CACNG6 polymorphisms with aspirin-intolerance asthmatics in a Korean population.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.