Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.88
PubTator Score 2.28

Knowledge Summary

Patent (613)

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 2.2e-03
atypical teratoid / rhabdoid tumor 1.100 8.1e-03
medulloblastoma, large-cell 1.400 1.2e-05
osteosarcoma 3.780 4.9e-11
ovarian cancer 1.400 1.4e-11

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKA      1 - 70
NGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLA     71 - 140
AAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPA    141 - 210
PRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT                        211 - 260
//

Text Mined References (7)

PMID Year Title