Property Summary

NCBI Gene PubMed Count 27
Grant Count 90
R01 Count 57
Funding $8,137,723.53
PubMed Score 67.79
PubTator Score 35.22

Knowledge Summary

Patent (1,658)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.142 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.001
lung cancer 1.600 0.000

Synonym

Accession Q9BXS9 B4DMZ1 Q548A7 Q96Q90 Q9NQU1
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (16)

PMID Text
26372434 Data show that SLC26A6 variants do not alter the risk for the development of chronic pancreatitis.
24603188 Molecular dynamics simulations of the STAS domains of rat prestin and human pendrin reveal conformational motions in conserved flexible regions.
20501439 In the intestinal epithelium, PAT-1 (SLC26A6) could mediate apical oxalate influx or apical oxalate efflux depending on the magnitude and direction prevailing counterion driver gradients as well as the relative affinities of the transported anions.
19910524 lysophosphatidic acid stimulates apical Cl(-)/OH(-) exchange activity and surface levels of SCL26A3 and SCL26A6 in intestinal epithelial cells
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19029225 Though the SLC26A6 206M polymorphism did not correlate with kidney stone development in primary hyperparathyroidism, PHPT stone-formers harbouring the M allele had a lower hypercalciuria
19029225 Observational study of gene-disease association. (HuGE Navigator)
18951670 SLC26A6 was effectively ruled out as the disease gene in this non-PH1/PH2 cohort. Phenotypic and functional analysis excluded a significant effect of identified variants on oxalate excretion.
18951670 Observational study of gene-disease association. (HuGE Navigator)
18655181 involvement of IRF-1 in the regulation of SLC26A6 gene expression by IFNgamma in the human intestine
More...

AA Sequence

MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWLQCSRARAYAL      1 - 70
LLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSR     71 - 140
HISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGLIHFGFVVTYL    141 - 210
SEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVV    211 - 280
KLLNDKLQQQLPMPIPGELLTLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFT    281 - 350
IAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA    351 - 420
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLD    421 - 490
LGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVYFANAEFYSDA    491 - 560
LKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKM    561 - 630
MQVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIE    631 - 700
VEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL               701 - 759
//

Text Mined References (30)

PMID Year Title
26372434 Genetic analysis of the bicarbonate secreting anion exchanger SLC26A6 in chronic pancreatitis.
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
24603188 2014 Molecular dynamics simulations of the STAS domains of rat prestin and human pendrin reveal conformational motions in conserved flexible regions.
20501439 2009 Parsing apical oxalate exchange in Caco-2BBe1 monolayers: siRNA knockdown of SLC26A6 reveals the role and properties of PAT-1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19910524 2010 Mechanisms of lysophosphatidic acid (LPA) mediated stimulation of intestinal apical Cl-/OH- exchange.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19029225 2009 Analysis of the 206M polymorphic variant of the SLC26A6 gene encoding a Cl- oxalate transporter in patients with primary hyperparathyroidism.
18951670 2008 Phenotypic and functional analysis of human SLC26A6 variants in patients with familial hyperoxaluria and calcium oxalate nephrolithiasis.
More...