Property Summary

NCBI Gene PubMed Count 40
PubMed Score 13.85
PubTator Score 5.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.147 2.7e-07
diabetes mellitus -1.100 2.9e-03
ovarian cancer 2.300 1.6e-06
pancreatic cancer 1.300 1.0e-03
pancreatic ductal adenocarcinoma liver m... -1.390 1.0e-03

Protein-protein Interaction (5)

Gene RIF (44)

AA Sequence

MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVAT      1 - 70
SKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGH     71 - 140
KLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPEL    141 - 210
RLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIE    211 - 280
SVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPG    281 - 350
GKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL    351 - 420
RTQ                                                                       421 - 423
//

Text Mined References (47)

PMID Year Title