Property Summary

NCBI Gene PubMed Count 39
PubMed Score 12.89
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.147 0.000
pancreatic ductal adenocarcinoma liver m... -1.390 0.001
diabetes mellitus -1.100 0.003
ovarian cancer 2.300 0.000
pancreatic cancer 1.300 0.001

Synonym

Accession Q9BXS5 Q4TTY5
Symbols AP47
CLTNM
MU-1A
CLAPM2

Gene

Gene RIF (67)

PMID Text
25496667 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
25449265 CNNM4 is sorted to the basolateral membrane by the complementary function of AP-1A and AP-1B
24843023 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
24843023 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
23705972 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
23705972 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
23705972 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
23678182 Adaptor protein 1 promotes cross-presentation through the same tyrosine signal in major histocompatibility complex class I as that targeted by HIV-1.
23678182 HIV-1 Nef downregulates CD4 and MHC I by connecting these receptors with the endocytic machinery through direct interactions between Nef and the mu medium chains of AP complexes, essential components of clathrin-coated pits
23478262 IRS-1 associates with mu1A of the ubiquitously expressed AP-1 complex through three protein interaction motifs.
More...

AA Sequence

MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVAT      1 - 70
SKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGH     71 - 140
KLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPEL    141 - 210
RLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIE    211 - 280
SVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPG    281 - 350
GKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL    351 - 420
RTQ                                                                       421 - 423
//

Text Mined References (46)

PMID Year Title
25449265 2014 Basolateral sorting of the Mg²? transporter CNNM4 requires interaction with AP-1A and AP-1B.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23678182 2013 Adaptor protein 1 promotes cross-presentation through the same tyrosine signal in major histocompatibility complex class I as that targeted by HIV-1.
23478262 2013 The AP-1 complex regulates intracellular localization of insulin receptor substrate 1, which is required for insulin-like growth factor I-dependent cell proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22301137 2012 A noncanonical mu-1A-binding motif in the N terminus of HIV-1 Nef determines its ability to downregulate major histocompatibility complex class I in T lymphocytes.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20833140 2010 Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 ?1A (AP-1 mu1A).
More...