Property Summary

NCBI Gene PubMed Count 10
PubMed Score 20.77
PubTator Score 12.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.6e-07
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 0.8
Disease Target Count Z-score Confidence
Multiple system atrophy 29 3.389 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.521 2.6e-07

Protein-protein Interaction (8)

Gene RIF (5)

AA Sequence

MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR      1 - 70
SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS     71 - 140
DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP    141 - 210
HLDDVTPFVELHKIHRV                                                         211 - 227
//

Text Mined References (10)

PMID Year Title