Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $523,693.67
PubMed Score 20.27
PubTator Score 12.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.521 0.000

Synonym

Accession Q9BXS1
Symbols IPPI2

Gene

PANTHER Protein Class (1)

PDB

2PNY  

Gene RIF (5)

PMID Text
25950736 The present findings suggest that IDI1 and IDI2 may be associated with the production of cholesterol metabolites in neurons, leading to alpha-synuclein aggregation during the process of Lewy body formation.
20955688 Within the 40-kb region on 10p15.3 subtelomere, which harbours two genes encoding isopentenyl diphosphate isomerase 1 (IDI1) and IDI2, there was found a segmental copy-number gain in a large proportion of sporadic amyotrophic lateral sclerosis patients.
17202134 Enzyme kinetic analysis; both isozymes IDI1 and IDI2 are localized to the peroxisome by a PTS1-dependent pathway; data suggest that IDI2 is regulated independently from IDI1, by a mechanism that may involve PPARalpha
16385451 Observational study of gene-disease association. (HuGE Navigator)
14629038 IDI2 is expressed at high levels only in skeletal muscle, where it may be involved in the specialized production of isoprenyl diphosphates for the posttranslational modification of proteins.

AA Sequence

MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR      1 - 70
SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS     71 - 140
DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP    141 - 210
HLDDVTPFVELHKIHRV                                                         211 - 227
//

Text Mined References (10)

PMID Year Title
25950736 2015 Isopentenyl diphosphate isomerase, a cholesterol synthesizing enzyme, is localized in Lewy bodies.
20955688 2010 Segmental copy-number gain within the region of isopentenyl diphosphate isomerase genes in sporadic amyotrophic lateral sclerosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17202134 2007 IDI2, a second isopentenyl diphosphate isomerase in mammals.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14629038 2003 Isopentenyl-diphosphate isomerases in human and mouse: evolutionary analysis of a mammalian gene duplication.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8806705 1996 Human isopentenyl diphosphate: dimethylallyl diphosphate isomerase: overproduction, purification, and characterization.