Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.57
PubTator Score 26.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
FIBROSIS OF EXTRAOCULAR MUSCLES, CONGENITAL, 5 1 0.0 0.0
Disease Target Count
Congenital ptosis 6
Disease Target Count P-value
pituitary cancer 1972 7.3e-03
medulloblastoma 720 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.7
Disease Target Count
Duane Retraction Syndrome 13
PTOS1 2

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma 1.100 3.8e-02
pituitary cancer 1.900 7.3e-03

Gene RIF (14)

AA Sequence

MLLKKHAGKGGGREPRSEDPTPAEQHCARTMPPCAVLAALLSVVAVVSCLYLGVKTNDLQARIAALESAK      1 - 70
GAPSIHLLPDTLDHLKTMVQEKVERLLAQKSYEHMAKIRIAREAPSECNCPAGPPGKRGKRGRRGESGPP     71 - 140
GQPGPQGPPGPKGDKGEQGDQGPRMVFPKINHGFLSADQQLIKRRLIKGDQGQAGPPGPPGPPGPRGPPG    141 - 210
DTGKDGPRGMPGVPGEPGKPGEQGLMGPLGPPGQKGSIGAPGIPGMNGQKGEPGLPGAVGQNGIPGPKGE    211 - 280
PGEQGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIKGEPGFIGPQG    281 - 350
EPGLPGLPGTKGERGEAGPPGRGERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQGPRGPPGQK    351 - 420
GDQGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGPKGEQGSPGIPGMDGEQGLKGSKGDMGDP    421 - 490
GMTGEKGGIGLPGLPGANGMKGEKGDSGMPGPQGPSIIGPPGPPGPHGPPGPMGPHGLPGPKGTDGPMGP    491 - 560
HGPAGPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFPGPRGEKGDLGEKGEKGFRGVKGEKGEPGQP    561 - 630
GLDGLDAPCQLGPDGLPMPGCWQK                                                  631 - 654
//

Text Mined References (21)

PMID Year Title