Property Summary

NCBI Gene PubMed Count 82
Grant Count 8
R01 Count 4
Funding $1,589,128.67
PubMed Score 56.14
PubTator Score 61.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.314 0.000
interstitial cystitis 2.300 0.007
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma -1.100 0.016
pilocytic astrocytoma 1.300 0.000
ulcerative colitis 1.400 0.003
psoriasis 1.100 0.000

Gene RIF (71)

PMID Text
26559190 concluded that TLR-1 rs4833095 and TLR10 rs10004195 confer susceptibility to development of gastroduodenal disease, especially GC in H.pylori disease
26364993 Data indicate that polymorphisms in toll like receptor 10 (TLR10) are not associated with chronic Q fever.
26312625 Study annotated variants at 4p14 as expression quantitative trait loci (eQTL) associated with TLR6/10 and FAM114A1; findings suggest that 4p14 polymorphisms are linked to host immune response to H. pylori infection but not to its acquisition.
25895985 genetic variants in TLR10 are associated with protection against complicated skin and skin structure infections
25857634 single nucleotide polymorphism (SNP) in TLR10 (rs11096957) is associated with risk for Tuberculosis
25850295 The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found.
25687912 TLR1 rs4833095 and TLR10 rs10004195 may play crucial roles in H. pylori susceptibility and gastric pathogenesis.
25295614 Our results suggest that TLR10 polymorphisms may contribute to the pathogenesis of autoimmune thyroid diseases.
25288745 TLR10 is a modulatory pattern-recognition receptor with mainly inhibitory properties
25028161 Genetic variation rs5743565 in TLR1 might be associated with the decreased susceptibility to Graves disease, whlie polymorphisms in TLR6 and TLR10 did not reach the statistical significance.
More...

AA Sequence

MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHS      1 - 70
VSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGN     71 - 140
MSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDG    141 - 210
IKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVT    211 - 280
FGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKF    281 - 350
QYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP    351 - 420
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRL    421 - 490
SVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLR    491 - 560
GTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLHFDLPWYLRMLGQCTQTWHRVRKTTQEQLKR    561 - 630
NVRFHAFISYSEHDSLWVKNELIPNLEKEDGSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNF    631 - 700
VQNEWCHYEFYFAHHNLFHENSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWAN    701 - 770
LRAAINVNVLATREMYELQTFTELNEESRGSTISLMRTDCL                                 771 - 811
//

Text Mined References (83)

PMID Year Title
26559190 2015 Polymorphisms at Locus 4p14 of Toll-Like Receptors TLR-1 and TLR-10 Confer Susceptibility to Gastric Carcinoma in Helicobacter pylori Infection.
26364993 2016 Genetic variation in TLR10 is not associated with chronic Q fever, despite the inhibitory effect of TLR10 on Coxiella burnetii-induced cytokines in vitro.
26312625 2015 Association of 4p14 TLR locus with antibodies to Helicobacter pylori.
25895985 2015 Genetic Variation in TLR10, an Inhibitory Toll-Like Receptor, Influences Susceptibility to Complicated Skin and Skin Structure Infections.
25857634 2015 Genetic Polymorphisms in the Toll-like Receptor 10, Interleukin (IL)17A and IL17F Genes Differently Affect the Risk for Tuberculosis in Croatian Population.
25850295 [Association of polymorphisms in toll-like receptor genes with atopic dermatitis in the Republic of Bashkortostan].
25687912 2015 Toll-like receptor 1 and 10 polymorphisms, Helicobacter pylori susceptibility and risk of gastric lesions in a high-risk Chinese population.
25295614 2015 Association of Toll-like receptor 10 polymorphisms with autoimmune thyroid disease in Korean children.
25288745 2014 Human TLR10 is an anti-inflammatory pattern-recognition receptor.
25028161 2015 Polymorphisms in TLR1, TLR6 and TLR10 genes and the risk of Graves' disease.
More...