Property Summary

NCBI Gene PubMed Count 88
PubMed Score 63.75
PubTator Score 61.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-03
Astrocytoma, Pilocytic 1.300 3.0e-05
group 3 medulloblastoma -1.100 1.6e-02
interstitial cystitis 1.900 1.1e-02
osteosarcoma -1.314 1.3e-05
psoriasis 1.100 2.0e-15
ulcerative colitis 1.400 3.2e-03

Protein-protein Interaction (9)

Gene RIF (77)

AA Sequence

MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHS      1 - 70
VSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGN     71 - 140
MSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDG    141 - 210
IKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVT    211 - 280
FGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKF    281 - 350
QYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP    351 - 420
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRL    421 - 490
SVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLR    491 - 560
GTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLHFDLPWYLRMLGQCTQTWHRVRKTTQEQLKR    561 - 630
NVRFHAFISYSEHDSLWVKNELIPNLEKEDGSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNF    631 - 700
VQNEWCHYEFYFAHHNLFHENSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWAN    701 - 770
LRAAINVNVLATREMYELQTFTELNEESRGSTISLMRTDCL                                 771 - 811
//

Text Mined References (89)

PMID Year Title