Property Summary

NCBI Gene PubMed Count 39
PubMed Score 0.00
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
23872666 ERVK6 gene insertion polymorphisms are associated with lung cancer.
20147518 Here, it was shown that human endogenous retrovirus Rec can form a trimeric complex with TZFP and AR, and can relieve the TZFP-mediated repression of AR-induced transactivation.
19220907 ERVK6 translocates Env into the endoplasmic reticulum lumen.
15735668 HERV-K rec has a role in disturbed germ cell development

AA Sequence

NKSRKRRNRESLLGAATVEPPKPIPLTWKTEKPVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWN      1 - 70
SPVFVIQKKSGKWRMLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKF     71 - 140
AFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVREKFSDCYIIHCIDDILCAAETKDKLI    141 - 210
DCYTFLQAEVANAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIRP    211 - 280
TLGIPTYAMSNLFSILRGDSDLNSKRMLTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTG    281 - 350
IIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRIIKLCGNDPDKIVVPLTKEQVRQAFINSGAW    351 - 420
KIGLANFVGIIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPY    421 - 490
QSAQRAELVAVITVLQDFDQPINIISDSAYVVQATRDVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFY    491 - 560
ITHIRAHTNLPGPLTKANEQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKDIVQHCTQCQVL    561 - 630
HLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAV    631 - 700
MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTT    701 - 770
PQMQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSP    771 - 840
GENQLPVWIPTRHLKFYNEPIRDAKKSTSAETETSQSSTVDSQDEQNGDVRRTDEVAIHQEGRAANLGTT    841 - 910
KEADAVSYKISREHKGDTNPREYAACSLDDCINGGKSPYACRSSCS                            911 - 956
//

Text Mined References (39)

PMID Year Title
23872666 2013 Identification and association study with lung cancer for novel insertion polymorphisms of human endogenous retrovirus.
23085571 2012 Reactivation of codogenic endogenous retroviral (ERV) envelope genes in human endometrial carcinoma and prestages: Emergence of new molecular targets.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
20147518 2010 Human endogenous retrovirus protein Rec interacts with the testicular zinc-finger protein and androgen receptor.
19220907 2009 Human endogenous retrovirus HERV-K(HML-2) encodes a stable signal peptide with biological properties distinct from Rec.
16830071 2006 Tempo and mode of ERV-K evolution in human and chimpanzee genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16211423 2005 Haplotype analysis of the human endogenous retrovirus locus HERV-K(HML-2.HOM) and its evolutionary implications.
15735668 2005 Human endogenous retrovirus rec interferes with germ cell development in mice and may cause carcinoma in situ, the predecessor lesion of germ cell tumors.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...