Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.69
PubTator Score 123.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 7.3e-06
ovarian cancer 8520 1.0e-05
psoriasis 6694 7.7e-05
Multiple myeloma 1332 4.8e-04
progressive supranuclear palsy 676 7.4e-03
Alzheimer's disease 658 2.6e-02
Disease Target Count Z-score Confidence
Shigellosis 21 4.59 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
Alzheimer's disease -1.100 2.6e-02
Multiple myeloma 1.212 4.8e-04
ovarian cancer 1.400 1.0e-05
Pick disease -1.400 7.3e-06
progressive supranuclear palsy -1.100 7.4e-03
psoriasis 1.500 7.7e-05

Gene RIF (4)

AA Sequence

MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRIC      1 - 70
LGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSP     71 - 140
EKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLR    141 - 210
ATCLEEMTKRDVPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDC    211 - 280
VFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNI    281 - 350
AYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITLG                     351 - 403
//

Text Mined References (13)

PMID Year Title