Property Summary

NCBI Gene PubMed Count 32
PubMed Score 24.11
PubTator Score 26.97

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Venous Thromboembolism 34
Disease Target Count P-value
pituitary cancer 1972 1.10967475353642E-7
malignant mesothelioma 3163 2.66213347874578E-7
posterior fossa group A ependymoma 1511 8.08192079101174E-6
group 3 medulloblastoma 2254 3.29552404214983E-5
osteosarcoma 7933 0.00386707516300725
adult high grade glioma 2148 0.00802462546931099
glioblastoma 5572 0.0349425546245047
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
pre-eclampsia 67 4.658 2.3
Down syndrome 548 3.058 1.5


  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
osteosarcoma 1.395 0.004
posterior fossa group A ependymoma 1.900 0.000
group 3 medulloblastoma 3.200 0.000
glioblastoma 1.300 0.035
adult high grade glioma 1.100 0.008
pituitary cancer -2.900 0.000


Accession Q9BXP8 A9Z1Y8 Q96PH7 Q96PH8 Q9H4C9
Symbols PAPPE


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (16)

26748159 PAPP-A2 is differentially expressed in different trophoblast populations and shows strong down regulation in the mid second trimester in chorionic villous samples.
25154785 overexpression in Down syndrome from placental mRNA to maternal serum protein
24672801 The association between this PAPPA2 single nucleotide polymorphism and developmental dysplasia of the hip was evaluated.
24336677 The upregulation of PAPP-A2 observed in preeclampsia at term occurs early in pregnancy, before the symptoms develop.
23804707 The existence of this assay will enable an assessment of the biomarker potential of PAPP-A2 in pre-eclampsia as well as other clinical conditions.
23484525 PAPPA2 may be upregulated in severe pre-eclampsia and, functionally, this may be mediated via increased placental hypoxia known to occur with this pregnancy disorder.
22037112 Association of a single nucleotide polymorphism in pregnancy-associated plasma protein-A2 with developmental dysplasia of the hip
21496272 factors previously known to be highly expressed in preeclamptic placentae (PGE2 and TNF-alpha), contribute to the upregulation of PAPPA2. results are consistent with the hypothesis that PAPPA2 is upregulated as a consequence of placental pathology
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20304771 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

CHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ                                1751 - 1791

Text Mined References (33)

PMID Year Title
26748159 2016 Differential expression of human placental PAPP-A2 over gestation and in preeclampsia.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25154785 2014 Pregnancy associated plasma protein-A2: a novel biomarker for Down syndrome.
24672801 2014 A replication study for the association of rs726252 in PAPPA2 with developmental dysplasia of the hip in Chinese Han population.
24336677 2014 First-trimester levels of pregnancy-associated plasma protein A2 (PAPP-A2) in the maternal circulation are elevated in pregnancies that subsequently develop preeclampsia.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
23804707 2013 A robust immunoassay for pregnancy-associated plasma protein-A2 based on analysis of circulating antigen: establishment of normal ranges in pregnancy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23484525 2014 PAPPA2 is increased in severe early onset pre-eclampsia and upregulated with hypoxia.