Property Summary

NCBI Gene PubMed Count 34
PubMed Score 108.46
PubTator Score 28.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.400 5.6e-03
ependymoma 1.200 3.6e-02
Gaucher disease type 1 -1.300 3.2e-02
group 3 medulloblastoma 1.100 2.2e-02
malignant mesothelioma 1.100 6.6e-06
oligodendroglioma 1.100 5.3e-03
osteosarcoma -1.239 1.6e-04
ovarian cancer 2.200 6.9e-07
pancreatic ductal adenocarcinoma liver m... 1.025 8.1e-03
psoriasis -1.800 6.3e-04

Gene RIF (12)

AA Sequence

MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERRSRGEYRDYDRNRRERFSPPR      1 - 70
HELSPPQKRMRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDVHIMQHHVLPIQARLGSIAEI     71 - 140
DLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRR    141 - 210
QEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKP    211 - 280
GEPSKKEEGRAGAGLGDGERKTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSK    281 - 350
KRNRKHSGDDSFDEGSVSESESESESGQAEEEKEEAEEALKEKEKPKEEEWEKPKDAAGLECKPRPLHKT    351 - 420
CSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLREC    421 - 490
ELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKN    491 - 560
ITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEY    561 - 630
PNEDEMPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKF    631 - 700
VTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQP    701 - 770
PGPAQILPPGLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFR    771 - 840
GQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF                                      841 - 876
//

Text Mined References (49)

PMID Year Title