Property Summary

NCBI Gene PubMed Count 31
Grant Count 100
R01 Count 75
Funding $8,263,295.95
PubMed Score 100.97
PubTator Score 28.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
ependymoma 1.200 0.036
oligodendroglioma 1.100 0.005
psoriasis -1.800 0.001
osteosarcoma -1.239 0.000
astrocytoma 1.600 0.004
pancreatic ductal adenocarcinoma liver m... 1.207 0.008
group 3 medulloblastoma 1.200 0.001
ovarian cancer 2.200 0.000
Gaucher disease type 1 -1.300 0.032

Synonym

Gene

 GO Component (2)

Gene RIF (10)

PMID Text
25530566 ARS2 and CASP8AP2 expressions can precisely predict high-risk of relapse and ALL prognosis.
24272391 Ars2 is overexpressed in HCC and may have prognostic value; it might play an important role in HCC proliferation and miR-21 expression.
22244333 Ars2 contributes to histone mRNA 3' end formation and expression and these functional properties of Ars2 are negatively regulated by interaction with 7SK RNA.
22213145 Ars2 is overexpressed in human cholangiocarcinoma and may be a diagnostic marker. Ars2 depletion increases PTEN and PDCD4 protein levels via the reduction of miR-21.
19632182 These findings provide evidence for a role for Ars2 in RNA interference regulation during cell proliferation.
19546234 Results suggest that FLASH functions in S phase progression through interaction with ARS2.
18854154 Knockdown of serrate RNA effector molecule homolog (SRRT) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18086880 These data indicate ARS2 is essential for early mammalian development and is likely involved in an essential cellular process.
17672918 Validated occurrence of an unusual TG 3' splice site in intron 17 (NM_015908).
10069470 Nomenclature. Original paper and GenBank submission by Rossman and Wang (1999) called the gene Asr2 (arsenite resistance protein 2) as opposed to Ars2 (arsenate resistance protein 2).

AA Sequence

MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERRSRGEYRDYDRNRRERFSPPR      1 - 70
HELSPPQKRMRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDVHIMQHHVLPIQARLGSIAEI     71 - 140
DLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRR    141 - 210
QEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKP    211 - 280
GEPSKKEEGRAGAGLGDGERKTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSK    281 - 350
KRNRKHSGDDSFDEGSVSESESESESGQAEEEKEEAEEALKEKEKPKEEEWEKPKDAAGLECKPRPLHKT    351 - 420
CSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLREC    421 - 490
ELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKN    491 - 560
ITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEY    561 - 630
PNEDEMPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKF    631 - 700
VTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQP    701 - 770
PGPAQILPPGLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFR    771 - 840
GQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF                                      841 - 876
//

Text Mined References (45)

PMID Year Title
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25530566 2015 Low expressions of ARS2 and CASP8AP2 predict relapse and poor prognosis in pediatric acute lymphoblastic leukemia patients treated on China CCLG-ALL 2008 protocol.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272391 2014 Expression and prognostic value of Ars2 in hepatocellular carcinoma.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...