Property Summary

NCBI Gene PubMed Count 12
Grant Count 318
R01 Count 226
Funding $16,840,378.38
PubMed Score 2.35
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma -3.203 0.000
tuberculosis 1.100 0.000

Synonym

Accession Q9BXP2 B7Z740 D6W5X0 D6W5X2 F5H8C2 Q9BWL2 Q9BXP1 Q9BYI0 Q9NQR5
Symbols CCC6
CIP1
WO3.3
hCCC6

Gene

Gene RIF (2)

PMID Text
23325410 Review summarizes three human disorders that have been linked to the mutation/dysfunction of Na-Cl, Na-K-2Cl, and K-Cl cotransporters (Bartter's, Gitleman's, and Andermann's syndromes).
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MASESSPLLAYRLLGEEGVALPANGAGGPGGASARKLSTFLGVVVPTVLSMFSIVVFLRIGFVVGHAGLL      1 - 70
QALAMLLVAYFILALTVLSVCAIATNGAVQGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLV     71 - 140
ESVLDVFGADATGPSGLRVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLIS    141 - 210
FVAVGPRDIRLTPRPGPNGSSLPPRFGHFTGFNSSTLKDNLGAGYAEDYTTGAVMNFASVFAVLFNGCTG    211 - 280
IMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGI    281 - 350
YATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAV    351 - 420
VTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLAA    421 - 490
LLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPRGALPLLRLANQLKKGGLY    491 - 560
VLGHVTLGDLDSLPSDPVQPQYGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLG    561 - 630
FYDDAPPQDHFLTDPAFSEPADSTREGSSPALSTLFPPPRAPGSPRALNPQDYVATVADALKMNKNVVLA    631 - 700
RASGALPPERLSRGSGGTSQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILGMVPAWHSARLRIFL    701 - 770
CLGPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEAEALARSANAL    771 - 840
VRAQQGRGTGGGPGGPEGGDAEGPITALTFLYLPRPPADPARYPRYLALLETLTRDLGPTLLVHGVTPVT    841 - 910
CTDL                                                                      911 - 914
//

Text Mined References (15)

PMID Year Title
23325410 2013 Physiology of SLC12 transporters: lessons from inherited human genetic mutations and genetically engineered mouse knockouts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...