Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.84
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Embryonal testis carcinoma 5 4.211 2.1

Gene RIF (2)

AA Sequence

MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNFKRTSPEELVND      1 - 70
HARKNRINPLQMEEEEFMEIMVEIPAK                                                71 - 97
//

Text Mined References (13)

PMID Year Title