Property Summary

NCBI Gene PubMed Count 65
PubMed Score 388.99
PubTator Score 137.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
Breast cancer 3099 7.20271715815163E-15
psoriasis 6685 2.08375204617471E-14
breast carcinoma 1614 2.33841227742021E-12
juvenile dermatomyositis 1189 1.346236086107E-9
Duchenne muscular dystrophy 602 1.2914481400381E-8
lung carcinoma 2844 2.67064238697163E-5
non-small cell lung cancer 2798 2.26474081236164E-4
primary pancreatic ductal adenocarcinoma 1271 3.27578151405789E-4
pancreatic cancer 2300 3.90802364074802E-4
sonic hedgehog group medulloblastoma 1482 5.29841535073375E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.98774189810736E-4
Chronic obstructive pulmonary disease 147 0.00100346428546335
intraductal papillary-mucinous adenoma (IPMA) 2956 0.001159185524681
glioblastoma 5572 0.00125797723693514
invasive ductal carcinoma 2950 0.0013652968287157
head and neck cancer 270 0.00159857280264869
interstitial cystitis 2299 0.00205967064335527
limb girdle muscular dystrophy 2A 156 0.00252435975839674
primary Sjogren syndrome 789 0.00774800877727271
adrenocortical carcinoma 1427 0.0111898166489913
gastric carcinoma 832 0.0112714074459167
pituitary cancer 1972 0.0118192680848233
pterygium 74 0.013263397439394
atypical teratoid / rhabdoid tumor 4369 0.0150167175764301
nasopharyngeal carcinoma 1056 0.0176576631307724
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0216181949567815
osteosarcoma 7933 0.0232894632986323
Gaucher disease type 3 76 0.0315477012039603
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0318684991892744
Becker muscular dystrophy 187 0.0345773802014632
Disease Target Count
Osteoarthritis susceptibility 3 1

Expression

Synonym

Accession Q9BXN1 Q5TBF3 Q96K79 Q96LD0 Q9NXP3
Symbols OS3
PLAP1
PLAP-1
SLRR1C

Gene

  Ortholog (11)

 IMPC Term (1)

 CSPA Cell Line (1)

Gene RIF (46)

PMID Text
26446945 To test the associations of ASPN variations with risk of subsequent oncologic outcomes.
26016288 this is the first case-control study in Mexican women that suggests that menopause and the D-repeat polymorphism in the ASPN gene are associated with knee OA
25673058 Collectively, our findings indicate that ASPN is upregulated and plays an oncogenic role in gastric cancer progression and metastasis by influencing the EGFR signaling pathway.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
25030405 Our results showed that ASPN rs13301537 T to C change and variant C genotype may contribute to knee OA risk in a Chinese Han population.
24453179 D14-PLAP-1 suppressed BMP-2 signal transduction more efficiently than D13-PLAP-1; stronger affinity of D14-PLAP-1 protein to BMP-2 compared with D13-PLAP-1 protein. D repeat polymorphism of PLAP-1/asporin has influence on functions of PDL cells.
24441039 Asporin may represent a new therapeutic target molecule for the development of drugs aimed at manipulating the cancer microenvironment.
24306268 This meta-analysis shows that the ASPN D14, D13, and D15 alleles are not associated with the development of osteoarthritis in Europeans and Asians. [Meta-Analysis]
24078942 Our data suggest that the D15 asporin allele could be considered a knee osteoarthritis risk allele significant only for women in the Iranian population.
24003854 The asporin-encoding gene is a promising candidate as a susceptibility gene for osteoarthritis and degenerative disc disease. [Review]
More...

AA Sequence

MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDDEDNSLFPTREPRSHFFPFD      1 - 70
LFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTK     71 - 140
IHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNN    141 - 210
GIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDI    211 - 280
ENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLF    281 - 350
NNPVKYWEMQPATFRCVLSRMSVQLGNFGM                                            351 - 380
//

Text Mined References (67)

PMID Year Title
26446945 2016 Germline Variants in Asporin Vary by Race, Modulate the Tumor Microenvironment, and Are Differentially Associated with Metastatic Prostate Cancer.
26016288 [D-repeat polymorphism in the ASPN gene in knee osteoarthritis in females in Torreón, Coahuila. Case-control study].
25673058 2015 Asporin participates in gastric cancer cell growth and migration by influencing EGF receptor signaling.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
25031006 2014 [Effect of light centrifugal force on the asporin gene expression in human periodontal ligament cells].
25030405 2014 Association between single nucleotide polymorphisms of asporin (ASPN) and BMP5 with the risk of knee osteoarthritis in a Chinese Han population.
24905804 2014 High-resolution molecular validation of self-renewal and spontaneous differentiation in clinical-grade adipose-tissue derived human mesenchymal stem cells.
24716474 2014 Genetic, clinical and radiographic signs in knee osteoarthritis susceptibility.
24708694 2014 The role of quantitative mass spectrometry in the discovery of pancreatic cancer biomarkers for translational science.
24453179 2014 Inhibitory effects of PLAP-1/asporin on periodontal ligament cells.
More...