Property Summary

NCBI Gene PubMed Count 71
PubMed Score 408.21
PubTator Score 137.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Degenerative disc disease 35 3.545 1.8
Disease Target Count Z-score Confidence
Hypochondrogenesis 3 3.023 1.5
Disease Target Count
Osteoarthritis susceptibility 3 1

Expression

Gene RIF (50)

AA Sequence

MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDDEDNSLFPTREPRSHFFPFD      1 - 70
LFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTK     71 - 140
IHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNN    141 - 210
GIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDI    211 - 280
ENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLF    281 - 350
NNPVKYWEMQPATFRCVLSRMSVQLGNFGM                                            351 - 380
//

Text Mined References (73)

PMID Year Title