Property Summary

NCBI Gene PubMed Count 65
Grant Count 43
R01 Count 17
Funding $2,723,689.24
PubMed Score 388.99
PubTator Score 137.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (46)

PMID Text
26446945 To test the associations of ASPN variations with risk of subsequent oncologic outcomes.
26016288 this is the first case-control study in Mexican women that suggests that menopause and the D-repeat polymorphism in the ASPN gene are associated with knee OA
25673058 Collectively, our findings indicate that ASPN is upregulated and plays an oncogenic role in gastric cancer progression and metastasis by influencing the EGFR signaling pathway.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
25030405 Our results showed that ASPN rs13301537 T to C change and variant C genotype may contribute to knee OA risk in a Chinese Han population.
24453179 D14-PLAP-1 suppressed BMP-2 signal transduction more efficiently than D13-PLAP-1; stronger affinity of D14-PLAP-1 protein to BMP-2 compared with D13-PLAP-1 protein. D repeat polymorphism of PLAP-1/asporin has influence on functions of PDL cells.
24441039 Asporin may represent a new therapeutic target molecule for the development of drugs aimed at manipulating the cancer microenvironment.
24306268 This meta-analysis shows that the ASPN D14, D13, and D15 alleles are not associated with the development of osteoarthritis in Europeans and Asians. [Meta-Analysis]
24078942 Our data suggest that the D15 asporin allele could be considered a knee osteoarthritis risk allele significant only for women in the Iranian population.
24003854 The asporin-encoding gene is a promising candidate as a susceptibility gene for osteoarthritis and degenerative disc disease. [Review]
More...

AA Sequence

MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDDEDNSLFPTREPRSHFFPFD      1 - 70
LFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTK     71 - 140
IHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNN    141 - 210
GIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDI    211 - 280
ENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLF    281 - 350
NNPVKYWEMQPATFRCVLSRMSVQLGNFGM                                            351 - 380
//

Text Mined References (67)

PMID Year Title
26446945 2016 Germline Variants in Asporin Vary by Race, Modulate the Tumor Microenvironment, and Are Differentially Associated with Metastatic Prostate Cancer.
26016288 [D-repeat polymorphism in the ASPN gene in knee osteoarthritis in females in Torreón, Coahuila. Case-control study].
25673058 2015 Asporin participates in gastric cancer cell growth and migration by influencing EGF receptor signaling.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
25031006 2014 [Effect of light centrifugal force on the asporin gene expression in human periodontal ligament cells].
25030405 2014 Association between single nucleotide polymorphisms of asporin (ASPN) and BMP5 with the risk of knee osteoarthritis in a Chinese Han population.
24905804 2014 High-resolution molecular validation of self-renewal and spontaneous differentiation in clinical-grade adipose-tissue derived human mesenchymal stem cells.
24716474 2014 Genetic, clinical and radiographic signs in knee osteoarthritis susceptibility.
24708694 2014 The role of quantitative mass spectrometry in the discovery of pancreatic cancer biomarkers for translational science.
24453179 2014 Inhibitory effects of PLAP-1/asporin on periodontal ligament cells.
More...