Property Summary

NCBI Gene PubMed Count 6
Grant Count 120
R01 Count 68
Funding $10,151,237.11
PubMed Score 1.50
PubTator Score 74.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BXM9 A2A338 A6NKH7 B7Z5S6 B7Z5W3 Q5T879 Q5T880
Symbols MIR1
CCDC10
FSD1CL
FSD1NL
CSDUFD1

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20800088 significant internalisation of type 2 cystatins from the extracellular to intracellular compartments

AA Sequence

MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDTLHHTLKGVQE      1 - 70
NSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCNNALENSEELLEFATRSLDIK     71 - 140
EPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVA    141 - 210
DNSVTVAWRMPEEDNKIDHFILEHRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRA    211 - 280
CNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKR    281 - 350
TSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSW    351 - 420
CIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMV    421 - 490
WCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ                                  491 - 530
//

Text Mined References (10)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20800088 2010 Cystatins--Extra- and intracellular cysteine protease inhibitors: High-level secretion and uptake of cystatin C in human neuroblastoma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19448620 2009 Meta-analysis of genome-wide association data identifies two loci influencing age at menarche.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11267680 2001 Characterization of human FSD1, a novel brain specific gene on chromosome 19 with paralogy to 9q31.