Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 74.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.572 5.4e-04
adrenocortical carcinoma 1.221 4.3e-03
adult high grade glioma -2.000 1.3e-03
Astrocytoma, Pilocytic -2.200 1.3e-06
atypical teratoid / rhabdoid tumor -2.400 2.0e-04
chronic rhinosinusitis -1.014 3.0e-02
cystic fibrosis and chronic rhinosinusit... -1.969 3.2e-02
diabetes mellitus -1.300 2.0e-03
ependymoma 1.300 2.9e-02
gastric cancer 1.400 3.2e-04
glioblastoma -1.500 5.3e-04
group 3 medulloblastoma 1.600 1.2e-04
intraductal papillary-mucinous adenoma (... -1.400 2.7e-03
juvenile dermatomyositis 1.195 6.7e-07
medulloblastoma, large-cell -1.900 6.5e-03
non primary Sjogren syndrome sicca -1.100 1.7e-02
ovarian cancer -1.200 1.7e-04
pituitary cancer 1.100 9.7e-04
sarcoidosis 1.500 3.5e-02

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDTLHHTLKGVQE      1 - 70
NSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCNNALENSEELLEFATRSLDIK     71 - 140
EPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVA    141 - 210
DNSVTVAWRMPEEDNKIDHFILEHRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRA    211 - 280
CNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKR    281 - 350
TSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSW    351 - 420
CIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMV    421 - 490
WCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ                                  491 - 530
//

Text Mined References (10)

PMID Year Title