Property Summary

NCBI Gene PubMed Count 299
PubMed Score 706.52
PubTator Score 576.28

Knowledge Summary

Patent (6,852)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 1.0e-03
atypical teratoid / rhabdoid tumor -1.500 1.8e-07
colon cancer -1.400 5.8e-05
esophageal adenocarcinoma -1.100 1.8e-02
glioblastoma -1.200 2.7e-06
group 3 medulloblastoma -1.700 4.9e-04
medulloblastoma, large-cell -2.200 6.3e-06
osteosarcoma -1.100 1.3e-03
primitive neuroectodermal tumor -1.600 2.6e-06
spina bifida -1.359 4.5e-02

Gene RIF (304)

AA Sequence

MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFF      1 - 70
RQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP     71 - 140
DPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPG    141 - 210
APAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRA    211 - 280
FTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGV    281 - 350
DHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST    351 - 420
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALL    421 - 490
QREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLA    491 - 560
NLECETLCQAALLLCSWRAAL                                                     561 - 581
//

Text Mined References (305)

PMID Year Title