Property Summary

NCBI Gene PubMed Count 276
Grant Count 276
R01 Count 112
Funding $30,792,198.18
PubMed Score 590.21
PubTator Score 576.28

Knowledge Summary

Patent (6,852)

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.018
osteosarcoma -1.100 0.001
glioblastoma -1.500 0.001
sonic hedgehog group medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.600 0.000
colon cancer -1.400 0.000
pediatric high grade glioma -1.400 0.000
spina bifida -1.359 0.045

Synonym

Accession Q9BXM7 Q8N6T9 Q8NBU3 Q96DE4
Symbols BRPK
PARK6

Gene

Gene RIF (281)

PMID Text
26555609 results indicate that PINK1 expression is positively regulated by NRF2 and that the NRF2-PINK1 signaling axis is deeply involved in cell survival.
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
26436374 Differential submitochondrial localization of PINK1 serves as a molecular switch for mediating two distinct mitochondrial signaling pathways in maintenance of mitochondrial homeostasis.
26282903 PINK1 variants are prevalent for causing Parkinson's disease in India
26266977 two receptors previously linked to xenophagy, NDP52 and optineurin, are the primary receptors for PINK1- and parkin-mediated mitophagy
26245297 High expression of PARK6 might lead to the occurrence of non-small-cell lung cancer.
26101826 pathogenic PINK1 mutants which are not cleaved by PARL affect PINK1 kinase activity and the ability to induce PARK2-mediated mitophagy.
26071202 These results suggest that pyruvate is required for CCCP-induced PINK1/PARK2-mediated mitophagy.
26070385 Suggest a protective role of PINK1/Parkin-mediated mitophagy against chlorpyrifos-induced neuroapoptosis.
26046594 Processing and shuttling of PINK1 through mitochondria is conformed to at least three possible functional microcompartments for PINK1 activity (I, cytosol; II, outer mitochondrial membrane; III, inside mitochondria).
More...

AA Sequence

MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFF      1 - 70
RQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP     71 - 140
DPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPG    141 - 210
APAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRA    211 - 280
FTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGV    281 - 350
DHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST    351 - 420
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALL    421 - 490
QREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLA    491 - 560
NLECETLCQAALLLCSWRAAL                                                     561 - 581
//

Text Mined References (281)

PMID Year Title
26555609 2015 NRF2 Regulates PINK1 Expression under Oxidative Stress Conditions.
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
26436374 2015 Differential submitochondrial localization of PINK1 as a molecular switch for mediating distinct mitochondrial signaling pathways.
26282903 2015 Novel P-TEN-induced putative kinase 1 (PINK1) variant in Indian Parkinson's disease patient.
26266977 2015 The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy.
26245297 2015 Status of the Parkinson's disease gene family expression in non-small-cell lung cancer.
26101826 2015 Intramembrane protease PARL defines a negative regulator of PINK1- and PARK2/Parkin-dependent mitophagy.
26071202 2015 Pyruvate stimulates mitophagy via PINK1 stabilization.
26070385 2015 PINK1/Parkin-mediated mitophagy alleviates chlorpyrifos-induced apoptosis in SH-SY5Y cells.
26046594 2015 Shuttling of PINK1 between Mitochondrial Microcompartments Resolved by Triple-Color Superresolution Microscopy.
More...