Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.45
PubTator Score 65.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (4)

PMID Text
18572021 an important role of CDCA4 in the context of transcriptional regulation and cell fate determination through the JUN oncogene
18498124 Data suggest that CDCA4 is involved in spindle organization from prometaphase, and when anaphase begins, it may play a different role as a midzone factor involved in chromosome segregation or cytokinesis.
16984923 CDCA4 participates in the regulation of cell proliferation, mainly through the E2F/retinoblastoma protein pathway
11482882 Isolation of the mouse ortholog and comparison to the human protein.

AA Sequence

MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQ      1 - 70
EEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRH     71 - 140
LQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGL    141 - 210
EGLAPATPGPSSSCKSDLGELDHVVEILVET                                           211 - 241
//

Text Mined References (10)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
18572021 2008 Transcriptional co-factor CDCA4 participates in the regulation of JUN oncogene expression.
18498124 2008 The spindle function of CDCA4.
16984923 2006 CDCA4 is an E2F transcription factor family-induced nuclear factor that regulates E2F-dependent transcriptional activation and cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12188893 2001 Drug target discovery by gene expression analysis: cell cycle genes.
11482882 Cloning and characterization of Hepp, a novel gene expressed preferentially in hematopoietic progenitors and mature blood cells.