Property Summary

NCBI Gene PubMed Count 86
PubMed Score 139.16
PubTator Score 98.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 2.5e-02

Synonym

Accession Q9BXL7 A4D1Z7 Q2NKN7 Q548H3
Symbols PPBL
BENTA
BIMP3
IMD11
CARMA1
IMD11A

Gene

PDB

4JUP   4LWD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (62)

AA Sequence

MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKI      1 - 70
NRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQ     71 - 140
QMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQ    141 - 210
LSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKN    211 - 280
QELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELK    281 - 350
CSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE    351 - 420
MVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYF    421 - 490
LPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSI    491 - 560
MSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDA    561 - 630
YDLEQVNLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSL    631 - 700
AEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRKLVKDMEDGLI    701 - 770
TSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQ    771 - 840
LLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKY    841 - 910
KRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFT    911 - 980
PTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNK    981 - 1050
HCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATV   1051 - 1120
EPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL                                       1121 - 1154
//

Text Mined References (92)

PMID Year Title