Property Summary

NCBI Gene PubMed Count 78
PubMed Score 129.23
PubTator Score 98.26

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 0.025


Accession Q9BXL7 A4D1Z7 Q2NKN7 Q548H3
Symbols PPBL



4JUP   4LWD  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid

Gene RIF (56)

26884335 Cooperative Control of Caspase Recruitment Domain-containing Protein 11 (CARD11) Signaling by an Unusual Array of Redundant Repressive Elements.
26884334 single amino acid oncogenic CARD11 mutations can perturb or bypass the action of redundant inhibitory REs to achieve the level of hyperactive CARD11 signaling required to support lymphoma growth.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26289640 Both carried homozygous germline mutations in CARD11 (p.Cys150*), impairing NF-kappaB signaling and IL-2 production
26212909 CARD11-mediated alterations in NF-kappaB signaling may be an early event in the development of cutaneous squamous cell carcinoma
26206083 Taken together, our data indicate that miR-539 is a novel regulator of migration and invasion in human thyroid cancer cells by targeting CARMA1.
25930198 Three patients have been described with mild B-cell lymphocytosis and a CARD11 C49Y missense mutation.
25602919 CARMA1 clustering through SH3-GUK domain interactions is required for its activation of NF-kappaB signalling
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.

AA Sequence

EPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL                                       1121 - 1154

Text Mined References (83)

PMID Year Title
26884335 2016 Cooperative Control of Caspase Recruitment Domain-containing Protein 11 (CARD11) Signaling by an Unusual Array of Redundant Repressive Elements.
26884334 2016 Intramolecular Interactions and Regulation of Cofactor Binding by the Four Repressive Elements in the Caspase Recruitment Domain-containing Protein 11 (CARD11) Inhibitory Domain.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26289640 2015 Omenn syndrome associated with a functional reversion due to a somatic second-site mutation in CARD11 deficiency.
26212909 2015 Novel CARD11 Mutations in Human Cutaneous Squamous Cell Carcinoma Lead to Aberrant NF-?B Regulation.
26206083 2015 MiR-539 inhibits thyroid cancer cell migration and invasion by directly targeting CARMA1.
25930198 2015 Mild B-cell lymphocytosis in patients with a CARD11 C49Y mutation.
25602919 2015 Clustering of CARMA1 through SH3-GUK domain interactions is required for its activation of NF-?B signalling.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.