Property Summary

NCBI Gene PubMed Count 34
PubMed Score 34.20
PubTator Score 20.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 3.7e-05
atypical teratoid / rhabdoid tumor -1.700 1.2e-10
ependymoma -1.100 4.6e-02
glioblastoma -1.200 2.1e-09
invasive ductal carcinoma -1.100 7.6e-03
medulloblastoma, large-cell 1.100 1.6e-04
osteosarcoma -2.319 8.4e-06
ovarian cancer -1.200 6.6e-04
pancreatic ductal adenocarcinoma liver m... -1.164 2.4e-02
primitive neuroectodermal tumor -1.100 9.7e-05

Gene RIF (13)

AA Sequence

MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSL      1 - 70
DKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLHKALQMLLSQPVTYQAFRECT     71 - 140
LETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQFGVTYLEDYSAEYIIQQGGWGTVFSLESEE    141 - 210
EEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIA    211 - 280
MDPEEVKSLDSNGAGEKSENNSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHIT    281 - 350
ATSLLGTREPDTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES    351 - 420
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVALALRKK         421 - 485
//

Text Mined References (40)

PMID Year Title