Property Summary

NCBI Gene PubMed Count 31
Grant Count 10
R01 Count 10
Funding $2,532,781
PubMed Score 31.29
PubTator Score 20.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.100 0.046
osteosarcoma -2.319 0.000
glioblastoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.164 0.024
pediatric high grade glioma -1.400 0.000
invasive ductal carcinoma -1.100 0.008
ovarian cancer 2.400 0.000

Gene RIF (12)

PMID Text
26146385 This study showed that Bcl-2-like protein 13 (Bcl2-L-13) induces mitochondrial fragmentation and mitophagy in mammalian cells.
24706805 Bcl2L13 binds to proapoptotic ceramide synthases 2 (CerS2) and 6 (CerS6) via a unique C-terminal 250-aa sequence located between its Bcl-2 homology and membrane anchor domains and blocks homo- and heteromeric CerS2/6 complex formation and activity.
22921587 Bcl-rambo is a pro-apoptotic member of the Bcl-2 family, inducing the permeability transition via interaction with the adenine nucleotide translocator (ANT).
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855536 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20109966 investigated the expression of three apoptosis related genes, BCL2L13, CASP8AP2, and Livin, as well as their prognostic significance, in a retrospective study of 90 pediatric ALL patients diagnosed between 1996 and 2007 in Taiwan
19064571 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSL      1 - 70
DKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLHKALQMLLSQPVTYQAFRECT     71 - 140
LETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQFGVTYLEDYSAEYIIQQGGWGTVFSLESEE    141 - 210
EEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIA    211 - 280
MDPEEVKSLDSNGAGEKSENNSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHIT    281 - 350
ATSLLGTREPDTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES    351 - 420
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVALALRKK         421 - 485
//

Text Mined References (37)

PMID Year Title
26146385 2015 Bcl-2-like protein 13 is a mammalian Atg32 homologue that mediates mitophagy and mitochondrial fragmentation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24706805 2014 Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22921587 2012 Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...