Property Summary

NCBI Gene PubMed Count 31
PubMed Score 31.29
PubTator Score 20.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 6.21986779730674E-12
pediatric high grade glioma 2712 1.10279279552013E-7
glioblastoma 5572 1.70854500179213E-6
osteosarcoma 7933 8.42421063668345E-6
primitive neuroectodermal tumor 3031 9.73932157750376E-5
ovarian cancer 8492 1.32533510423901E-4
medulloblastoma, large-cell 6234 2.6641430375311E-4
invasive ductal carcinoma 2950 0.00759615036579079
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0239522949657672
ependymoma 2514 0.0460046388149628

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.100 0.046
osteosarcoma -2.319 0.000
glioblastoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.164 0.024
pediatric high grade glioma -1.400 0.000
invasive ductal carcinoma -1.100 0.008
ovarian cancer 2.400 0.000

Synonym

Accession Q9BXK5 B3KPE7 Q96B37 Q96IB7 Q9BY01 Q9HC05 Q9UFE0 Q9UKN3 Bcl2-L-13
Symbols MIL1
BCL-RAMBO
Bcl2-L-13

Gene

PDB

2IPD  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

Gene RIF (12)

PMID Text
26146385 This study showed that Bcl-2-like protein 13 (Bcl2-L-13) induces mitochondrial fragmentation and mitophagy in mammalian cells.
24706805 Bcl2L13 binds to proapoptotic ceramide synthases 2 (CerS2) and 6 (CerS6) via a unique C-terminal 250-aa sequence located between its Bcl-2 homology and membrane anchor domains and blocks homo- and heteromeric CerS2/6 complex formation and activity.
22921587 Bcl-rambo is a pro-apoptotic member of the Bcl-2 family, inducing the permeability transition via interaction with the adenine nucleotide translocator (ANT).
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855536 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20109966 investigated the expression of three apoptosis related genes, BCL2L13, CASP8AP2, and Livin, as well as their prognostic significance, in a retrospective study of 90 pediatric ALL patients diagnosed between 1996 and 2007 in Taiwan
19064571 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSL      1 - 70
DKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLHKALQMLLSQPVTYQAFRECT     71 - 140
LETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQFGVTYLEDYSAEYIIQQGGWGTVFSLESEE    141 - 210
EEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIA    211 - 280
MDPEEVKSLDSNGAGEKSENNSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHIT    281 - 350
ATSLLGTREPDTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES    351 - 420
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVALALRKK         421 - 485
//

Text Mined References (37)

PMID Year Title
26146385 2015 Bcl-2-like protein 13 is a mammalian Atg32 homologue that mediates mitophagy and mitochondrial fragmentation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24706805 2014 Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22921587 2012 Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...