Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.36
PubTator Score 3.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.885 0.000
breast carcinoma 1.200 0.044

Gene RIF (4)

PMID Text
22203677 Detailed structural-functional analysis of the Kruppel-like factor 16 (KLF16) transcription factor reveals novel mechanisms for silencing Sp/KLF sites involved in metabolism and endocrinology.
17688680 Observational study of gene-disease association. (HuGE Navigator)
15937668 Observational study of gene-disease association. (HuGE Navigator)
12036432 protein analysis of BTEB3 and BTEB4 and their binding to CYP1A1

AA Sequence

MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGP      1 - 70
GAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYK     71 - 140
SSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHP    141 - 210
GFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPAGL                                211 - 252
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22203677 2012 Detailed structural-functional analysis of the Krüppel-like factor 16 (KLF16) transcription factor reveals novel mechanisms for silencing Sp/KLF sites involved in metabolism and endocrinology.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17688680 2007 Analysis of KLF transcription factor family gene variants in type 2 diabetes.
17480121 2007 Identification of the imprinted KLF14 transcription factor undergoing human-specific accelerated evolution.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
More...