Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.84
PubTator Score 3.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.4e-06
breast carcinoma 1638 4.4e-02
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 17 16 4.052 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.200 4.4e-02
osteosarcoma -1.885 3.4e-06

Gene RIF (4)

AA Sequence

MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGP      1 - 70
GAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYK     71 - 140
SSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHP    141 - 210
GFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPAGL                                211 - 252
//

Text Mined References (13)

PMID Year Title