Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
R01 Count 2
Funding $428,429.25
PubMed Score 109.50
PubTator Score 106.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 2.200 0.003
astrocytic glioma -1.700 0.035
oligodendroglioma -1.700 0.044
psoriasis 1.200 0.000
osteosarcoma 2.058 0.000
limb girdle muscular dystrophy 2A -1.043 0.007
Atopic dermatitis 1.400 0.003
acute myeloid leukemia 1.500 0.044
ulcerative colitis 1.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q9BXJ9 D3DNY6 Q52LG9 Q8IWH4 Q8NEV2 Q9H8P6
Symbols Ga19
NATH
TBDN
NARG1
NAT1P
TBDN100

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
23557624 Development of the first N-terminal acetyltransferase (NAT) inhibitors, including inhibitors to the NatA complex composed of Naa10 (ARD1) and Naa15 (NATH).
23043182 Protein N-terminal acetyltransferases (NATs), including the NatA complex composed of Naa10 (ARD1) and Naa15 (NATH), act as N-terminal propionyltransferases.
20154145 Data indicate that the physical interaction between HYPK and NatA Naa10/15 seems to be of functional importance both for huntingtin aggregation and for N-terminal acetylation.
16518407 Essential role in cell survival through protein N-alpha-acetylation.
16518308 Loss of retinal endothelial Tbdn-1 expression may be a contributing factor in retinal blood vessel proliferation in retinopathy of prematurity.
16279846 levels of endogenous NATH and hARD1 proteins in thyroid papillary carcinoma patients; results suggest that NATH positively affects the level of hARD1 protein both in vivo and in cell cultures
15496142 Human Naa15 (NATH) and Naa10 (ARD1) form a stable NatA complex which associates with ribosomes and performs co-translational N-terminal acetylation; Naa15 (NATH) and Naa10 (ARD1) are cleaved during apoptosis resulting in decreased acetyltransferase activity
15496142 description of the human homologue of Nat1p, NATH (NAT human), as the binding partner of the hARD1 (human ARD1) protein
15496142 NATH complexes with hARD1 in a ribosomal associated protein-N-acetyltransferase complex.
12140756 NATH, a novel gene overexpressed in papillary thyroid carcinomas.

AA Sequence

MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVR      1 - 70
RGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQL     71 - 140
LQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREAL    141 - 210
EHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIY    211 - 280
EEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE    281 - 350
TSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKH    351 - 420
AGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTE    421 - 490
CAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVDLLKLEDVLRQHPFYFKAARI    491 - 560
AIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKNAEKEKQQRNQKKKKDD    561 - 630
DDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFA    631 - 700
IDSSHPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAK    701 - 770
MVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMP    771 - 840
PGYEEDMKITVNGDSSAEAEELANEI                                                841 - 866
//

Text Mined References (38)

PMID Year Title
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
23557624 2013 Design, synthesis, and kinetic characterization of protein N-terminal acetyltransferase inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043182 2013 Protein N-terminal acetyltransferases act as N-terminal propionyltransferases in vitro and in vivo.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20154145 2010 The chaperone-like protein HYPK acts together with NatA in cotranslational N-terminal acetylation and prevention of Huntingtin aggregation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...