Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.41
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 5.85841645686733E-17
oligodendroglioma 2849 1.12486874000557E-14
pilocytic astrocytoma 3086 4.67224243022916E-9
adult high grade glioma 2148 1.17161817047175E-7
glioblastoma 5572 9.07790575202685E-7
medulloblastoma, large-cell 6234 1.36311464178017E-5
atypical teratoid / rhabdoid tumor 4369 7.49739643173865E-5
sonic hedgehog group medulloblastoma 1482 1.4029305584309E-4
pituitary cancer 1972 3.89268494724272E-4
primitive neuroectodermal tumor 3031 4.87451016613915E-4
mucosa-associated lymphoid tissue lymphoma 480 0.00607487838360918
subependymal giant cell astrocytoma 2287 0.00818944211871573
Pick disease 1893 0.0218492982873512
astrocytic glioma 2241 0.0238174279678204

Expression

  Differential Expression (14)

Gene RIF (2)

PMID Text
24366864 These results establish CTRP4 as a novel nutrient-responsive central regulator of food intake and energy balance.
21658842 CTRP4 is a novel tumor-promoting inflammatory regulator.

AA Sequence

MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC      1 - 70
RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP     71 - 140
QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI    141 - 210
GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR    211 - 280
GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL                         281 - 329
//

Text Mined References (5)

PMID Year Title
24366864 2014 C1q/TNF-related protein 4 (CTRP4) is a unique secreted protein with two tandem C1q domains that functions in the hypothalamus to modulate food intake and body weight.
21658842 2011 Identification of C1qTNF-related protein 4 as a potential cytokine that stimulates the STAT3 and NF-?B pathways and promotes cell survival in human cancer cells.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.