Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.70
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -4.300 1.2e-07
astrocytic glioma -2.000 2.4e-02
Astrocytoma, Pilocytic -3.500 6.7e-09
atypical teratoid / rhabdoid tumor -2.600 7.5e-05
ependymoma -2.600 2.3e-02
glioblastoma -3.400 5.2e-11
medulloblastoma -1.400 1.5e-02
medulloblastoma, large-cell -3.400 1.4e-05
mucosa-associated lymphoid tissue lympho... -1.106 6.1e-03
oligodendroglioma -1.800 1.1e-14
Pick disease -1.300 2.2e-02
pituitary cancer -1.500 3.9e-04
primitive neuroectodermal tumor -1.900 4.9e-04
subependymal giant cell astrocytoma -2.369 8.2e-03

Gene RIF (2)

AA Sequence

MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC      1 - 70
RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP     71 - 140
QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI    141 - 210
GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR    211 - 280
GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL                         281 - 329
//

Text Mined References (5)

PMID Year Title