Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.09
PubTator Score 2.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.200 3.8e-05
ductal carcinoma in situ -1.500 3.2e-02
fibroadenoma -1.100 4.4e-02
head and neck cancer -2.000 3.1e-02
interstitial cystitis -1.300 3.9e-02
intraductal papillary-mucinous adenoma (... -2.900 1.3e-03
intraductal papillary-mucinous carcinoma... -3.400 6.0e-04
intraductal papillary-mucinous neoplasm ... -3.600 5.2e-03
invasive ductal carcinoma -1.900 2.6e-02
lung adenocarcinoma -1.100 5.3e-10
lung carcinoma -1.600 7.5e-14
non-small cell lung cancer -1.026 1.1e-16
ovarian cancer -1.900 6.9e-06
pituitary cancer 1.200 1.0e-02
psoriasis -1.600 3.1e-26

Gene RIF (3)

AA Sequence

MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRK      1 - 70
GEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCR     71 - 140
CGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGL    141 - 210
VHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYL    211 - 280
DSISEDDEL                                                                 281 - 289
//

Text Mined References (9)

PMID Year Title