Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
Funding $26,648.67
PubMed Score 1.27
PubTator Score 2.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (3)

PMID Text
20585324 found four markers that meet the criteria for genome-wide significance (P<5x10-8) with the CD symptom count, two of which are located in the gene C1QTNF7 (C1q and tumor necrosis factor-related protein 7).
20585324 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRK      1 - 70
GEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCR     71 - 140
CGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGL    141 - 210
VHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYL    211 - 280
DSISEDDEL                                                                 281 - 289
//

Text Mined References (9)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.