Property Summary

NCBI Gene PubMed Count 21
Grant Count 6
Funding $41,279.79
PubMed Score 18.29
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

 GO Function (1)

Gene RIF (13)

PMID Text
25767880 the strong association of CTRP1 with insulin resistance in NAFLD
25635749 The variation of plasma CTRP-1 and IL-6 concentrations may play an important role in reflecting the degree of inflammation in CHD and the severity of coronary arterial atherosclerosis.
24965225 Increased plasma CTRP1 was independently associated with type 2 diabetes. Profiling of plasma adipokines such as CTRP1 is particularly important to obtain a greater understanding of their contribution to the type 2 diabetic state.
24945145 The levels of circulating CTRP1 are associated with coronary artery disease in men.
24827430 CTRP1 is a novel adipokine associated with type 2 diabetes mellitus in humans.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of C1q and tumor necrosis factor related protein 1 (C1QTNF1) in peptide-treated PBMCs
23000311 CTRP1 level was significantly higher in subjects with metabolic syndrome compared to healthy subjects.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18783346 CTRP1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.
18171693 CTRP1 enhances the production of aldosterone. CTRP1 was highly expressed in obese subjects as well as up-regulated in hypertensive patients, CTRP1 may be a newly identified molecular link between obesity and hypertension.
More...

AA Sequence

MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPA      1 - 70
SRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMGAPGER     71 - 140
CKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNMFTGKFYCYVPGLYFFSLNVHTWNQKETYLH    141 - 210
IMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQVWVRLYKGERENAIFSEELDTYITFSGYLVKHATE    211 - 280
P//

Text Mined References (22)

PMID Year Title
25767880 2015 Circulating level of CTRP1 in patients with nonalcoholic fatty liver disease (NAFLD): is it through insulin resistance?
25635749 2015 Plasma levels of C1q/TNF-related protein 1 and interleukin 6 in patients with acute coronary syndrome or stable angina pectoris.
25416956 2014 A proteome-scale map of the human interactome network.
24965225 2014 Elevated circulating levels of CTRP1, a novel adipokine, in diabetic patients.
24945145 2014 Association of circulating C1q/TNF-related protein 1 levels with coronary artery disease in men.
24827430 2014 Circulating complement-C1q TNF-related protein 1 levels are increased in patients with type 2 diabetes and are associated with insulin sensitivity in Chinese subjects.
23000311 2013 Development of a novel enzyme-linked immunosorbent assay (ELISA) for measurement of serum CTRP1: a pilot study: measurement of serum CTRP1 in healthy donors and patients with metabolic syndrome.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18783346 2008 Molecular, biochemical and functional characterizations of C1q/TNF family members: adipose-tissue-selective expression patterns, regulation by PPAR-gamma agonist, cysteine-mediated oligomerizations, combinatorial associations and metabolic functions.
18171693 2008 A novel adipokine CTRP1 stimulates aldosterone production.
More...