Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1.27
PubTator Score 37.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR      1 - 70
PGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVT     71 - 140
GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVG    141 - 210
VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA                                         211 - 243
//

Text Mined References (34)

PMID Year Title