Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.06
PubTator Score 5.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.013 0.025
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.001
non-small cell lung cancer 1.238 0.000
adult high grade glioma 1.200 0.000
lung adenocarcinoma 2.400 0.000
invasive ductal carcinoma 1.223 0.000
inflammatory breast cancer 1.500 0.016
ductal carcinoma in situ 1.100 0.035
ovarian cancer 1.100 0.003

Gene RIF (7)

PMID Text
26648301 CTRP6 inhibits the proliferation and migration of ovarian cancer cells via blocking IL-8/VEGF pathway.
26404464 CTRP6 is expressed in human synoviocytes, and CTRP6 levels are increased in RA patients.
25962701 AMPK and Akt activation are responsible for the CTRP6-mediated anti-fibrotic effect by targeting RhoA/MRTF-A pathway
21508531 C1qTNF6 is overexpressed and possibly contributes to tumor angiogenesis by activating the Akt pathway in many hepatocellular carcinomas.
20410501 Observational study of gene-disease association. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPY      1 - 70
INITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGED     71 - 140
FQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIM    141 - 210
QSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD                         211 - 259
//

Text Mined References (22)

PMID Year Title
26648301 2015 [C1q tumor necrosis factor-related protein 6 (CTRP6) inhibits the proliferation and migration of ovarian cancer cells].
26404464 2015 CTRP6 is an endogenous complement regulator that can effectively treat induced arthritis.
25962701 2015 C1q/tumor necrosis factor-related protein-6 attenuates post-infarct cardiac fibrosis by targeting RhoA/MRTF-A pathway and inhibiting myofibroblast differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21508531 2011 Expression of a secretory protein C1qTNF6, a C1qTNF family member, in hepatocellular carcinoma.
20410501 2010 Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo.
More...