Property Summary

NCBI Gene PubMed Count 23
PubMed Score 13.31
PubTator Score 5.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 1.3e-04
atypical teratoid / rhabdoid tumor 1.300 2.5e-06
ductal carcinoma in situ 1.100 3.5e-02
glioblastoma 1.300 1.2e-03
inflammatory breast cancer 1.500 1.6e-02
invasive ductal carcinoma 1.223 6.6e-05
lung adenocarcinoma 2.400 5.2e-12
non-small cell lung cancer 1.238 2.2e-15
osteosarcoma 1.013 2.5e-02
ovarian cancer 1.100 2.5e-03

Gene RIF (10)

AA Sequence

MGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPY      1 - 70
INITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGED     71 - 140
FQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIM    141 - 210
QSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD                         211 - 259
//

Text Mined References (25)

PMID Year Title