Property Summary

NCBI Gene PubMed Count 13
Grant Count 18
R01 Count 14
Funding $2,180,817.83
PubMed Score 129.57
PubTator Score 159.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 0.033

Gene RIF (6)

PMID Text
25892010 Anti-NT5C1A is a common target of circulating autoantibodies in autoimmune diseases.
25857661 seropositivity to the NT5c1A antibody is associated with greater motor and functional disability in sporadic inclusion body myositis
21873433 NT5C1A suppression promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle
19352542 There was no correlation between expression of cN-I and fiber type.
17065091 deoxycytidine kinase, deoxyguanosine kinase, and cytosolic 5'-nucleotidase I are regulated in a cell cycle-dependent manner in MOLT-4 cells
15888028 overexpression of 5'-nucleotidase inhibits Natural Killer cell cytotoxicity to ameliorate rejection after xenotransplantation

AA Sequence

MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQI      1 - 70
YTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINS     71 - 140
INHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVVVSQSQLRVAF    141 - 210
DGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLV    211 - 280
TARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG    281 - 350
VAQTPRRTAPAKQAPSAQ                                                        351 - 368
//

Text Mined References (13)

PMID Year Title
25892010 2016 Cytosolic 5'-Nucleotidase 1A As a Target of Circulating Autoantibodies in Autoimmune Diseases.
25857661 2016 Seropositivity for NT5c1A antibody in sporadic inclusion body myositis predicts more severe motor, bulbar and respiratory involvement.
25416956 2014 A proteome-scale map of the human interactome network.
21873433 2011 Suppression of 5'-nucleotidase enzymes promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
19352542 2009 Expression of cytosolic 5' nucleotidase does not correlate with expression of oxidative metabolism marker: myoglobine in human skeletal muscles.
17065091 2006 Cell cycle dependent regulation of deoxycytidine kinase, deoxyguanosine kinase, and cytosolic 5'-nucleotidase I activity in MOLT-4 cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15888028 2005 Expression of human ecto-5'-nucleotidase in pig endothelium increases adenosine production and protects from NK cell-mediated lysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...