Property Summary

NCBI Gene PubMed Count 155
PubMed Score 79.24
PubTator Score 42.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 4.148 2.1

Synonym

Accession Q9BXH1 B9EGI3 O00171 Q96PG9
Symbols JFY1
PUMA
JFY-1

Gene

PDB

2M04   4BPI   4BPJ   4BPK   4HNJ  

Gene RIF (136)

PMID Text
26576741 p53/PUMA expression in human pulmonary fibroblasts mediates cell activation and migration in silicosis
26431330 Suggest that the accumulation of PUMA in the cytosol may be important for the participation of this protein in apoptosis without the need for prior transcription in Burkitt's lymphoma b cells.
26397233 our data purport that p53 not only increased Puma expression directly, but that it may also do so through miR-203. Additionally, functional studies revealed that miR-203 overexpression induced apoptosis and inhibited cell invasiveness.
26397041 in vitro OGT knockdown induced more cell apoptosis through increasing PUMA and caspase-3 expression
26212789 the selective degradation of BBC3 underlies the prosurvival role of chaperone-mediated autophagy.
26125773 There-fore, stable transfection of PUMA can significantly enhance epirubicin-induced apoptosis sensitivity of MCF-7 breast cancer cells.
26043078 Activation of p38 and Jun kinase results in increased expression of the pro-apoptotic Bcl-2 homologs Bim and Puma, which inducibly bind and sequester Mcl-1 and Bcl-xL leading to the induction of the mitochondrial apoptosis pathway.
26030884 Puma is the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization induction.
25895606 Decrease of survivin expression and induction of PUMA expression.
25893985 inhibition of AKT/FoxO3a signaling may contribute to H1-mediated PUMA induction, suggesting that inhibition of AKT/FoxO3a signaling result in PUMA expression in response to p53-independent cytotoxic effects of H1.
More...

AA Sequence

MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA      1 - 70
ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ     71 - 140
LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN                     141 - 193
//

Text Mined References (159)

PMID Year Title
26576741 2015 p53/PUMA expression in human pulmonary fibroblasts mediates cell activation and migration in silicosis.
26431330 2015 Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells.
26397233 2015 MicroRNA-203 induces apoptosis by upregulating Puma expression in colon and lung cancer cells.
26397041 2015 Silencing ?-linked N-acetylglucosamine transferase induces apoptosis in human gastric cancer cells through PUMA and caspase-3 pathways.
26212789 2015 Chaperone-mediated autophagy prevents apoptosis by degrading BBC3/PUMA.
26125773 2015 PUMA gene transfection can enhance the sensitivity of epirubicin-induced apoptosis of MCF-7 breast cancer cells.
26043078 2015 Thiazolides promote apoptosis in colorectal tumor cells via MAP kinase-induced Bim and Puma activation.
26030884 2015 Phylogenetically Distant Viruses Use the Same BH3-Only Protein Puma to Trigger Bax/Bak-Dependent Apoptosis of Infected Mouse and Human Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895606 2015 Synergistic Induction of Erlotinib-Mediated Apoptosis by Resveratrol in Human Non-Small-Cell Lung Cancer Cells by Down-Regulating Survivin and Up-Regulating PUMA.
More...