Property Summary

NCBI Gene PubMed Count 170
PubMed Score 88.05
PubTator Score 42.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 4.296 2.1

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (151)

AA Sequence

MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA      1 - 70
ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ     71 - 140
LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN                     141 - 193
//

Text Mined References (174)

PMID Year Title