Property Summary

NCBI Gene PubMed Count 155
PubMed Score 79.24
PubTator Score 42.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 4.148 2.1

Synonym

Accession Q9BXH1 B9EGI3 O00171 Q96PG9
Symbols JFY1
PUMA
JFY-1

Gene

PDB

2M04   4BPI   4BPJ   4BPK   4HNJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (136)

PMID Text
26576741 p53/PUMA expression in human pulmonary fibroblasts mediates cell activation and migration in silicosis
26431330 Suggest that the accumulation of PUMA in the cytosol may be important for the participation of this protein in apoptosis without the need for prior transcription in Burkitt's lymphoma b cells.
26397233 our data purport that p53 not only increased Puma expression directly, but that it may also do so through miR-203. Additionally, functional studies revealed that miR-203 overexpression induced apoptosis and inhibited cell invasiveness.
26397041 in vitro OGT knockdown induced more cell apoptosis through increasing PUMA and caspase-3 expression
26212789 the selective degradation of BBC3 underlies the prosurvival role of chaperone-mediated autophagy.
26125773 There-fore, stable transfection of PUMA can significantly enhance epirubicin-induced apoptosis sensitivity of MCF-7 breast cancer cells.
26043078 Activation of p38 and Jun kinase results in increased expression of the pro-apoptotic Bcl-2 homologs Bim and Puma, which inducibly bind and sequester Mcl-1 and Bcl-xL leading to the induction of the mitochondrial apoptosis pathway.
26030884 Puma is the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization induction.
25895606 Decrease of survivin expression and induction of PUMA expression.
25893985 inhibition of AKT/FoxO3a signaling may contribute to H1-mediated PUMA induction, suggesting that inhibition of AKT/FoxO3a signaling result in PUMA expression in response to p53-independent cytotoxic effects of H1.
25846496 PUMA expression increases further during transformation while the expression of p53 is not significantly altered which suggests that PUMA alterations might be a late event during the evolution of myelodysplastic syndromes.
25831048 puma-mediated apoptosis is not induced in mucosal melanomas by cisplatin
25812964 Slug inversely regulated PUMA and p53 expression in both CNE-2 and CNE-2-RES cells.
25684518 Loss of PUMA is associated with lung cancer.
25647720 Upregulation of PUMA is associated with metastatic breast cancer.
25585941 PUMA is silenced in bladder cancer by miR-221.
25544752 Results establish that Tip60-T158 phosphorylation by p38 plays an essential role in stimulating Tip60 activity required for inducing the p53-PUMA pathway that ultimately leads to apoptosis in response to DNA damage.
25499216 Taken together, our results indicate that DNA damage resistance in RCC is reversible, involves the p53-PUMA axis, and is potentially targetable to improve the oncological outcomes of RCC patients.
25474084 The present study explored the role and mechanism of miR-222 in increasing the expression of p53 up-regulated modulator of apoptosis (PUMA) and enhancing the sensitivity of oral squamous cell carcinoma to cisplatin.
25356864 caspase-9 mediates Puma activation to determine the threshold for overcoming chemoresistance in cancer cells.
25354317 Beta-arrestin 2 promotes inflammation-induced intestinal epithelial apoptosis through endoplasmic reticulum stress/PUMA in colitis.
25012639 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis
24830722 Slug promotes survival during metastasis through suppression of Puma-mediated apoptosis.
24824714 PUMA protein in p53 regulatory molecule pattern determines the prognosis for patients with lymphoproliferative diseases.
24769730 Stable knockdown of Bim or PUMA expression prevented cell toxicity induced by loss of Keap1.
24685133 PUMA depletion is sufficient to prevent the sensitization to apoptosis that occurs when autophagy is blocked.
24625987 PUMA mediates endoplasmic reticulum stress-induced mucosal epithelial apoptosis through the mitochondrial apoptotic pathway in portal hypertensive gastropathy.
24625983 Data demonstrate that high concentrations of glucose induce endoplasmic reticulum and oxidative stress, which causes pancreatic beta cell death mediated by Bim and Puma.
24566851 c-Jun transactivates Puma gene expression to promote osteoarthritis.
24452416 MiR-222 targets the expression of PUMA in oral squamous cell carcinoma cells and affects cell growth, invasive and apoptotic abilities.
24265320 these results provide strong evidence that Puma, like Bim, Noxa, and tBid, is able to act as a direct Bak activator.
24236056 HER2-mediated phosphorylation destabilizes PUMA protein.
24127039 The results have shown that the proliferation of the tumor was inhibited after delivery of WWOX, and the expressions of P73 and PUMA were upregulated in target tissues.
24077289 ESR2 induces apoptosis of prostate cancer cells by increasing transcription of FOXO3a, leading to an increase of PUMA.
23916609 Sox4 is required for p53-independent apoptotic cell death mediated by PUMA induction via TSA treatment
23873935 a polymorphism in the miR-149 precursor may result in important phenotypic traits of myocardial infarction by regulating the puma protein in apoptosis
23532334 BIM and PUMA are induced upon HER2 inhibition in HER2-amplified breast cancers to execute apoptosis.
23517560 The BH3-only protein Puma plays an essential role in p53-mediated apoptosis of chronic lymphocytic leukemia cells.
23475628 High expression of PUMA is associated with lymph node metastasis and invasion in gallbladder adenocarcinoma.
23340338 The PUMA-induced partial unfolding of BCL-xL disrupts interactions between cytosolic p53 and BCL-xL, releasing the bound p53 to initiate apoptosis.
23321162 High levels of PUMA in pancreatic ductal adenocarcinoma tumour cells suggest that PUMA expression may play a role in pancreatic tumourigenesis.
23243310 Transforming growth factor-beta directly induces p53-up-regulated modulator of apoptosis (PUMA) during the rapid induction of apoptosis in myc-driven B-cell lymphomas
23220852 we confirmed the model of BBC3-mediated apoptosis, which can be activated with or without p53.
23001513 The binding of PUMA to the inhibitory members of the Bcl-2 family (Bcl-2-like proteins) via its BH3 domain seems to be a critical regulatory step in the induction of apoptosis.
22997714 [review] Small molecules like p21 and PUMA may play a role in the pathogenesis of rheumatoid arthritis.
22773666 Data suggest that PUMA/BBC3 and DP5 (death protein DP5) contribute to palmitate-induced apoptosis of pancreatic beta-cells via lipotoxic endoplasmic reticulum stress.
22763818 Histone deacetylase 3 inhibits expression of PUMA in gastric cancer cells; patients with low PUMA expression have significant decreases in overall survival.
22714709 PUMA, c-Myb and p53 protein expression closely relates to the carcinogenesis, fast-progression, easy-metastasis, high-invasion, and poor-prognosis in gallbladder adenocarcinoma.
22446329 these study suggested that the four mutations lowered the stability of the p53 DBD domain and induced aggregation of structurally destabilized p53, and thus disrupted the p53-PUMA/NOXA interaction.
22394200 The JNK-potentiated Akt/FoxO3a and JNK-mediated c-Jun pathways co-operatively trigger Puma expression, which determines the threshold for overcoming chemoresistance in ovarian cancer cells.
22359675 Bim-independent apoptosis by BITC in cancer cells is mediated by PUMA
22286758 Sorafenib kills cancer cells by activating PUMA.
22283740 Silibinin up-regulated PUMA expression. Pifithrin-alpha reduced it. p53 could interfere with mitochondrial functions such as MMP via PUMA pathways.
22178394 Studies indicate that PUMA and TOMM22 as potential targets for miRNA-BART viral transcripts.
22159712 In tumors the frequency of p53 positivity was 24%, that of bax positivity was 83%, and strong positivity was found for PUMA (43%).
22130069 Smad4 suppresses the PAK1, which promotes the PUMA destabilization
22086558 the PUMA promoter polymorphisms may be a biomarker for risk of HPV16-associated squamous cell carcinoma of the head and neck
22021910 The PUMA expression induced by stretch is mediated by IFN-gamma, JNK, and IRF-1 pathways.
21997190 Cytokine receptor signaling activates an IKK-dependent phosphorylation of PUMA to prevent cell death.
21887277 p21 prevents Puma and its downstream effector Bax from triggering the mitochondrial apoptotic pathway.
21868573 Puma is a major regulator of memory B lymphocyte survival and therefore a key molecule in the control of the immune response.
21863213 PUMA enhances sensitivity of SKOV3 cells to cisplatin by lowering the threshold set simultaneously by Bcl-x(L) and Mcl-1.
21699775 In mice and humans, colon inflammation induces apoptosis of intestinal epithelial cells via p53-dependent and - independent mechanisms; PUMA also activates an intrinsic apoptosis pathway associated with colitis.
21633093 Micro RNA miR-296-5p takes part in the regulation of PUMA expression during hepatic lipoapoptosis.
21490394 PUMA induction contributes to the pathogenesis of colitis by promoting IEC apoptosis
21364664 The phosphorylation of Puma at serine 10 promotes Puma turnover, represses Puma's cell death potential and promotes cell survival.
21159778 Akt requires glucose metabolism to suppress puma expression and prevent apoptosis of leukemic T cells.
21153863 Expression of p53-inducible BH3-only apoptotic proteins Puma and Noxa was elevated and large activation of executive caspases was observed.
21120639 rAAV2-Slug siRNA, in combination with radiation, increased levels of the PUMA, which contributes to the radiosensitivity of cholangiocarcinomas.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21044367 Observational study of gene-disease association. (HuGE Navigator)
21042732 PUMA is a direct target of miR-221/222 that functions as an endogenous apoptosis regulator in these epithelial cancers.
20978166 PUMA-mediated apoptosis is pivotal for the anticancer activities of UCN-01; PUMA manipulation may be useful for improving their anticancer activities.
20813046 Data indicate for the first time that miR-221/222 directly regulate apoptosis by targeting PUMA in glioblastoma and that miR-221/222 could be potential therapeutic targets for glioblastoma intervention.
20723285 Puma mRNA expression is significantly correlated with prognostic factors, and may be a prognostic marker of chronic lymphocytic leukemia.
20478995 PUMA (p53 up-regulated modulator of apoptosis), a key mediator of p53-dependent cell death, is regulated by a noncanonical, gene-specific mechanism
20430872 Collectively, these data suggest that CHOP and AP-1(c-Jun) cooperatively mediate PUMA induction during hepatocyte lipoapoptosis.
20421300 Data show that transcriptional activation of PUMA is regulated by nuclear factor-kappaB and endoplasmic reticulum stress.
20419447 Data show that in the presence of a functional p53/Puma/Bax-signaling axis, p14(ARF)-triggered apoptosis is enhanced by loss of p21(CDKN1)-mediated cell cycle checkpoint control.
20418652 Slug gene facilitates apoptosis of fibroblast-like synoviocytes by increasing Puma transactivation.
20413175 Sharply p53-insensitive down-regulation of PUMA, coupled with Bcl-X(L) up-regulation, may play a cytoprotective role in liver regeneration after hepatectomy
20206402 palmitoleate inhibits lipoapoptosis by blocking endoplasmic reticulum stress-associated increases of the BH3-only proteins Bim and PUMA
20075864 On mild DNA damage, SMAR1 selectively represses BAX and PUMA through binding to the MAR independently of inducing p53 deacetylation through HDAC1.
19966853 Data show that suppression of PUMA through the phosphoinositide 3-kinase (PI3K)/protein kinase B (AKT)/p53 axis in the intestinal stem cells as a novel molecular mechanism of growth factor-mediated intestinal radioprotection.
19851330 We conclude that IRF-1 can induce apoptosis by the intrinsic pathway independent of the extrinsic pathway by upregulation of PUMA.
19815839 Data show that both Akt inhibitors decreased MCL-1 protein level, increased PUMA and NOXA protein levels, and induced apoptosis irrespective of TP53 status.
19737931 Interference with Puma induction or expression of MCL1 or BCL2 significantly reduced both glucocorticoid- and FAS-induced cell death in p16INK4A-reconstituted leukemia cells.
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19660860 Autophagic cell death is induced as an alternative form of cell death by 5-fluorouracil in Bax or PUMA deficient HCT116 cells which are apoptosis defective.
19641508 PUMA is a critical mediator of p53-dependent & -independent apoptosis induced by a wide variety of stimuli.It directly binds and antagonizes all known antiapoptotic Bcl-2 family members to induce mitochondrial dysfunction & caspase activation. Review.
19638343 Data show that PUMA expression was increased in liver biopsy specimens from patients with non-alcoholic steatohepatitis.
19587239 MAP4K3 orchestrates activation of BAX via the concerted posttranscriptional modulation of PUMA, BAD, and BIM.
19444283 The induction of PUMA was p53 independent, and mediated by the p65 component of NF-kappaB through a kappaB site in the PUMA promoter.
19439449 Studies create an important conclusion that PUMA promotes Bax translocation both by directly interacting with Bax and by competitive binding to Bcl-X(L) in UV-induced apoptosis.
19421143 Results suggest that PUMA induction through p73 represents a new mechanism of EGFR inhibitor-induced apoptosis, and provide potential ways for enhancing and predicting the sensitivity to EGFR-targeted therapies in HNSCC.
19380879 Results suggest that Puma is competent to trigger Bax activity by itself, thereby promoting cellular dependence on prosurvival Bcl-2 family members.
19064725 loss of Puma only provided transient protection from apoptosis in hematopoietic progenitor cells, human leukemic cell lines, and primary AML cells
19050264 Upregulation of Puma is required for HIV-1 gp120-mediated syncytial apoptosis
19028473 PUMA makes a key contribution to the process whereby kaempferol induces ATM protein phosphorylation.
18941118 Up-regulation of miR-34a after irradiation was associated with induction of Bax and p21, but not Puma
18835564 These results demonstrate that the level of the Bcl-2 prosurvival family sets the threshold at which Puma is able to indirectly activate Bax or Bak, leading in turn to activation of caspases that cause cell death.
18811981 PUMA (p53-upregulated modulator of apoptosis) plays a role in H2O2-induced apoptosis in colorectal cancer cells.
18579560 transcription factors Sp1 and p73 mediate p53-independent induction of PUMA following serum starvation to trigger apoptosis in human cancer cells.
18573879 Puma deletion in the Emu-Myc mouse model of Burkitt lymphoma accelerates lymphomagenesis and that approximately 75% of Emu-Myc lymphomas naturally select against Puma protein expression.
18367875 PUMA is involved in green tea polyphenol-induced apoptosis in colorectal cancer cell lines
18354037 Noxa and Puma bind Mcl-1 to release Bak and Bim within 6 hours of arsenic trioxide addition
18324703 A p53-upregulated modulator of apoptosis (Puma) protein accumulated significantly in genistein-treated A549 and WI-38 cells.
18215742 PUMA exerts a negative feedback on p53 and p21, leading to p21-dependent growth suppressive and survival changes.
17996028 critical involvement of p38 MAPK, PUMA, and Bax in 6-OHDA-induced apoptosis
17934815 Differential expression of PUMA between non-neoplastic and neoplastic hepatocellular cells suggests that regulation of PUMA expression may play a role in development of hepatocellular carcinoma.
17698840 Mcl-1 confers TRAIL resistance by serving as a buffer for Bak, Bim, and Puma, and sorafenib is a potential modulator of TRAIL sensitivity
17616685 GADD153 (CHOP) and Bcl-2-binding component 3 (PUMA) and apoptosis are induced by 4-hydroxybenzylretinone in a process that is caspase- dependent and independent of the retinoic acid receptor
17393317 Expression of BBC3 protein was increased in the colorectal cancer cells and may possibly alter the cell death regulation during colorectal tumorigenesis.
17368424 findings suggest that PUMA plays an important role in celecoxib-induced mitochondrial dysfunction and the resulting apoptosis
17360476 the binding of nuclear p53 to the specific sites within the PUMA promoter is essential for its ability to induce apoptosis and is likely to be required for its tumor suppressive capacity
17267315 Differential expression of PUMA between normal and neoplastic gastric cells suggests that regulation of PUMA expression might play a possible role in the development of gastric adenocarcinoma.
17011204 Upregulation of Puma is required for HIV-1 gp120-mediated syncytial apoptosis
16983338 p53 activation and the transcriptional induction of its target gene PUMA play an important role in the sensitivity of cancer cells to apoptosis induced by proteasome inhibition
16608847 PUMA initiates apoptosis in part by dissociating Bax and Bcl-X(L), thereby promoting Bax multimerization and mitochondrial translocation
16462759 interference with the p53/PUMA/Bax cascade is crucial for the antiapoptotic function of the viral E6 oncogene in HPV-positive cancer cells
16151013 demonstrated that a tripartite nexus between Bcl-xL, cytoplasmic p53, and PUMA coordinates the nuclear and cytoplasmic p53 proapoptotic functions
16091745 BBC3 mediates fenretinide-induced cell death in neuroblastoma.
16007132 The interaction of PUMA with MCL1 is not sufficient to prevent rapid degradation of MCL1.
15905879 Results demonstrate that thapsigargin engages PUMA and Bax for full transduction of apoptotic signals and both PUMA and Bax appear to exist in the same apoptotic pathway in which PUMA may reside upstream of Bax.
15731089 degraded in Chlamydia trachomatis-infected cells.
15731037 degraded during Chlamydia trachomatis infection
15595728 histones and a ubiquitin conjugate protein UBC9, which are involved in DNA double-strand break (DSB) repair were significantly down-regulated in the PUMA-overexpressing apoptotic cells, suggesting the detection of DSB in the apoptotic process
15574335 a specific interaction between Bax Halpha1 and their BH3 domains allows Bid and PUMA to function as "death agonists" of Bax
15547745 PUMA expression may be of minor importance in the development of colorectal cancer
15143349 In the absence of PUMA, there is no HIV apoptosis.
14993250 Upregulation of Puma is required for HIV-1 gp120-mediated syncytial apoptosis
14634023 findings demonstrate that p73 protein elicits apoptosis via the mitochondrial pathway using p53 up regulated modulator of apoptosis(PUMA) and Bax protein as mediators
14585351 PUMA is an essential mediator of p53-dependent and -independent apoptosis in vivo
14550297 PUMA-induced Bax conformational change and Bax translocation to mitochondria can be separate events and the conformational change in Bax is crucial for PUMA-induced mitochondrial dysfunction
12963126 PUMA suppresses tumor cell growth in head/neck cancer, but it does not appear to be a direct target of inactivation in head and neck tumorigenesis.
12574499 role in mediating the apoptotic response to p53 in colorectal cancer cells

AA Sequence

MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA      1 - 70
ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ     71 - 140
LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN                     141 - 193
//

Text Mined References (159)

PMID Year Title
26576741 2015 p53/PUMA expression in human pulmonary fibroblasts mediates cell activation and migration in silicosis.
26431330 2015 Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells.
26397233 2015 MicroRNA-203 induces apoptosis by upregulating Puma expression in colon and lung cancer cells.
26397041 2015 Silencing ?-linked N-acetylglucosamine transferase induces apoptosis in human gastric cancer cells through PUMA and caspase-3 pathways.
26212789 2015 Chaperone-mediated autophagy prevents apoptosis by degrading BBC3/PUMA.
26125773 2015 PUMA gene transfection can enhance the sensitivity of epirubicin-induced apoptosis of MCF-7 breast cancer cells.
26043078 2015 Thiazolides promote apoptosis in colorectal tumor cells via MAP kinase-induced Bim and Puma activation.
26030884 2015 Phylogenetically Distant Viruses Use the Same BH3-Only Protein Puma to Trigger Bax/Bak-Dependent Apoptosis of Infected Mouse and Human Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895606 2015 Synergistic Induction of Erlotinib-Mediated Apoptosis by Resveratrol in Human Non-Small-Cell Lung Cancer Cells by Down-Regulating Survivin and Up-Regulating PUMA.
25893985 2015 Inhibition of AKT/FoxO3a signaling induced PUMA expression in response to p53-independent cytotoxic effects of H1: A derivative of tetrandrine.
25846496 2015 Clinical and pathological correlations of marrow PUMA and P53 expressions in myelodysplastic syndromes.
25831048 2015 Cisplatin fails to induce puma mediated apoptosis in mucosal melanomas.
25812964 2015 Slug mediates nasopharyngeal carcinoma radioresistance via downregulation of PUMA in a p53-dependent and -independent manner.
25684518 2015 Exogenous p53 upregulated modulator of apoptosis (PUMA) decreases growth of lung cancer A549 cells.
25647720 2015 Ras suppressor-1 promotes apoptosis in breast cancer cells by inhibiting PINCH-1 and activating p53-upregulated-modulator of apoptosis (PUMA); verification from metastatic breast cancer human samples.
25585941 2015 MiR-221-induced PUMA silencing mediates immune evasion of bladder cancer cells.
25544752 2014 Phosphorylation of Tip60 by p38? regulates p53-mediated PUMA induction and apoptosis in response to DNA damage.
25499216 2014 Harnessing the p53-PUMA axis to overcome DNA damage resistance in renal cell carcinoma.
25474084 2014 MiR-222 targeted PUMA to improve sensitization of UM1 cells to cisplatin.
25356864 2014 Caspase-9 mediates Puma activation in UCN-01-induced apoptosis.
25354317 2015 ?-Arrestin2 encourages inflammation-induced epithelial apoptosis through ER stress/PUMA in colitis.
25012639 2014 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis.
24830722 2014 Slug promotes survival during metastasis through suppression of Puma-mediated apoptosis.
24824714 2014 PUMA protein in p53 regulatory molecule pattern determines the prognosis for patients with lymphoproliferative diseases.
24769730 2014 Degradation of Keap1 activates BH3-only proteins Bim and PUMA during hepatocyte lipoapoptosis.
24685133 2014 Autophagy controls the kinetics and extent of mitochondrial apoptosis by regulating PUMA levels.
24625987 2014 PUMA mediates ER stress-induced apoptosis in portal hypertensive gastropathy.
24625983 2014 The proapoptotic BH3-only proteins Bim and Puma are downstream of endoplasmic reticulum and mitochondrial oxidative stress in pancreatic islets in response to glucotoxicity.
24566851 2014 c-Jun transactivates Puma gene expression to promote osteoarthritis.
24452416 2014 miR-222 regulates the cell biological behavior of oral squamous cell carcinoma by targeting PUMA.
24265320 2014 Evaluation of the BH3-only protein Puma as a direct Bak activator.
24236056 2013 HER2 phosphorylates and destabilizes pro-apoptotic PUMA, leading to antagonized apoptosis in cancer cells.
24127039 2014 WW domain containing oxidoreductase induces apoptosis in gallbladder-derived malignant cell by upregulating expression of P73 and PUMA.
24077289 2014 Estrogen receptor ? upregulates FOXO3a and causes induction of apoptosis through PUMA in prostate cancer.
23916609 2013 Transcription factor Sox4 is required for PUMA-mediated apoptosis induced by histone deacetylase inhibitor, TSA.
23873935 2013 A pre-microRNA-149 (miR-149) genetic variation affects miR-149 maturation and its ability to regulate the Puma protein in apoptosis.
23532334 2013 PUMA and BIM are required for oncogene inactivation-induced apoptosis.
23517560 2013 The BH3-only protein Puma plays an essential role in p53-mediated apoptosis of chronic lymphocytic leukemia cells.
23475628 2013 Expression of p53 upregulated modulator of apoptosis (PUMA) and C-myb in gallbladder adenocarcinoma and their pathological significance.
23340338 2013 PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
23321162 2012 Prognostic significance of PUMA in pancreatic ductal adenocarcinoma.
23243310 2013 Transforming growth factor-? directly induces p53-up-regulated modulator of apoptosis (PUMA) during the rapid induction of apoptosis in myc-driven B-cell lymphomas.
23220852 2012 BBC3 is down-regulated with increased tumor size independently of p53 expression in head and neck cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001513 2012 PUMA, a critical mediator of cell death--one decade on from its discovery.
22997714 2012 [Small molecules--principal participants of pathogenesis of rheumatoid arthritis].
22773666 2012 Death protein 5 and p53-upregulated modulator of apoptosis mediate the endoplasmic reticulum stress-mitochondrial dialog triggering lipotoxic rodent and human ?-cell apoptosis.
22763818 2013 Histone deacetylase 3 inhibits expression of PUMA in gastric cancer cells.
22761832 2012 CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress.
22714709 2013 Immunohistochemical study of PUMA, c-Myb and p53 expression in the benign and malignant lesions of gallbladder and their clinicopathological significances.
22516262 2012 Chemical genomics identifies small-molecule MCL1 repressors and BCL-xL as a predictor of MCL1 dependency.
22446329 2012 In vitro binding properties of tumor suppressor p53 with PUMA and NOXA.
22394200 2012 JNK- and Akt-mediated Puma expression in the apoptosis of cisplatin-resistant ovarian cancer cells.
22359675 2012 Critical role of p53 upregulated modulator of apoptosis in benzyl isothiocyanate-induced apoptotic cell death.
22286758 2012 Inhibiting oncogenic signaling by sorafenib activates PUMA via GSK3? and NF-?B to suppress tumor cell growth.
22283740 2012 P53 activation plays a crucial role in silibinin induced ROS generation via PUMA and JNK.
22178394 2012 The role of miRNAs and EBV BARTs in NPC.
22174832 2011 Human embryonic stem cells express elevated levels of multiple pro-apoptotic BCL-2 family members.
22159712 2012 The apoptosis regulators p53, bax and PUMA: Relationship and impact on outcome in early stage (FIGO I-II) ovarian carcinoma after post-surgical taxane-based treatment.
22130069 2011 Novel tumor suppressive function of Smad4 in serum starvation-induced cell death through PAK1-PUMA pathway.
22086558 2012 Genetic variants of a BH3-only pro-apoptotic gene, PUMA, and risk of HPV16-associated squamous cell carcinoma of the head and neck.
22021910 2012 Mechanical stretch induces the apoptosis regulator PUMA in vascular smooth muscle cells.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21997190 2012 Cytokine receptor signaling activates an IKK-dependent phosphorylation of PUMA to prevent cell death.
21887277 2011 Serum-nutrient starvation induces cell death mediated by Bax and Puma that is counteracted by p21 and unmasked by Bcl-x(L) inhibition.
21868573 2011 Regulation of memory B-cell survival by the BH3-only protein Puma.
21863213 2011 The p53 upregulated modulator of apoptosis (PUMA) chemosensitizes intrinsically resistant ovarian cancer cells to cisplatin by lowering the threshold set by Bcl-x(L) and Mcl-1.
21699775 2011 p53 and PUMA independently regulate apoptosis of intestinal epithelial cells in patients and mice with colitis.
21633093 2011 A role for miR-296 in the regulation of lipoapoptosis by targeting PUMA.
21490394 2011 PUMA-mediated intestinal epithelial apoptosis contributes to ulcerative colitis in humans and mice.
21486225 2011 Regulation of mitochondrial metabolism: yet another facet in the biology of the oncoprotein Bcl-2.
21364664 2010 Phosphorylation of Puma modulates its apoptotic function by regulating protein stability.
21364604 2011 In vivo contributions of BH3-only proteins to neuronal death following seizures, ischemia, and traumatic brain injury.
21269460 2011 Initial characterization of the human central proteome.
21159778 2011 Akt requires glucose metabolism to suppress puma expression and prevent apoptosis of leukemic T cells.
21153863 2011 Decitabine-induced apoptosis is derived by Puma and Noxa induction in chronic myeloid leukemia cell line as well as in PBL and is potentiated by SAHA.
21151175 2011 Apoptosis promotes early tumorigenesis.
21120639 2011 Slug inhibition upregulates radiation-induced PUMA activity leading to apoptosis in cholangiocarcinomas.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
21042732 2010 PUMA is a novel target of miR-221/222 in human epithelial cancers.
21041309 2011 BH3 domains other than Bim and Bid can directly activate Bax/Bak.
20978166 2010 PUMA induction by FoxO3a mediates the anticancer activities of the broad-range kinase inhibitor UCN-01.
20813046 2010 MiR-221 and miR-222 target PUMA to induce cell survival in glioblastoma.
20810912 2010 Hypoxia downregulates p53 but induces apoptosis and enhances expression of BAD in cultures of human syncytiotrophoblasts.
20723285 2010 [Detection of puma mRNA levels by real-time quantitative RT-PCR in chronic lymphocytic leukemia and its clinical significance].
20627101 2010 The fast-mobility isoform of mouse Mcl-1 is a mitochondrial matrix-localized protein with attenuated anti-apoptotic activity.
20478995 2010 Gene-specific repression of the p53 target gene PUMA via intragenic CTCF-Cohesin binding.
20430872 2010 CHOP and AP-1 cooperatively mediate PUMA expression during lipoapoptosis.
20421300 2010 p53 up-regulated modulator of apoptosis (PUMA) activation contributes to pancreatic beta-cell apoptosis induced by proinflammatory cytokines and endoplasmic reticulum stress.
20419447 2010 Systematic genetic dissection of p14ARF-mediated mitochondrial cell death signaling reveals a key role for p21CDKN1 and the BH3-only protein Puma/bbc3.
20418652 2010 Slug suppression induces apoptosis via Puma transactivation in rheumatoid arthritis fibroblast-like synoviocytes treated with hydrogen peroxide.
20413175 2010 p53-insensitive PUMA down-regulation is essential in the early phase of liver regeneration after partial hepatectomy in mice.
20206402 2010 Palmitoleate attenuates palmitate-induced Bim and PUMA up-regulation and hepatocyte lipoapoptosis.
20075864 2010 Coordinated regulation of p53 apoptotic targets BAX and PUMA by SMAR1 through an identical MAR element.
19966853 2010 Growth factors protect intestinal stem cells from radiation-induced apoptosis by suppressing PUMA through the PI3K/AKT/p53 axis.
19851330 2010 IRF-1 transcriptionally upregulates PUMA, which mediates the mitochondrial apoptotic pathway in IRF-1-induced apoptosis in cancer cells.
19815839 2009 Akt inhibitors induce apoptosis in chronic lymphocytic leukemia cells.
19737931 2009 p16INK4A sensitizes human leukemia cells to FAS- and glucocorticoid-induced apoptosis via induction of BBC3/Puma and repression of MCL1 and BCL2.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19660860 2010 Autophagic cell death induced by 5-FU in Bax or PUMA deficient human colon cancer cell.
19652530 2009 PUMA cooperates with direct activator proteins to promote mitochondrial outer membrane permeabilization and apoptosis.
19641508 2008 PUMA, a potent killer with or without p53.
19638343 2009 JNK1-dependent PUMA expression contributes to hepatocyte lipoapoptosis.
19587239 2009 MAP4K3 modulates cell death via the post-transcriptional regulation of BH3-only proteins.
19444283 2009 PUMA is directly activated by NF-kappaB and contributes to TNF-alpha-induced apoptosis.
19439449 2009 PUMA promotes Bax translocation by both directly interacting with Bax and by competitive binding to Bcl-X L during UV-induced apoptosis.
19421143 2009 PUMA mediates EGFR tyrosine kinase inhibitor-induced apoptosis in head and neck cancer cells.
19380879 2009 Bax activation by the BH3-only protein Puma promotes cell dependence on antiapoptotic Bcl-2 family members.
19064725 2009 BH3-only protein Bim more critical than Puma in tyrosine kinase inhibitor-induced apoptosis of human leukemic cells and transduced hematopoietic progenitors carrying oncogenic FLT3.
19028473 2009 Kaempferol induces apoptosis in human HCT116 colon cancer cells via the Ataxia-Telangiectasia Mutated-p53 pathway with the involvement of p53 Upregulated Modulator of Apoptosis.
18941118 2009 miR-34a as part of the resistance network in chronic lymphocytic leukemia.
18835564 2008 Triggering of apoptosis by Puma is determined by the threshold set by prosurvival Bcl-2 family proteins.
18811981 2008 Sp1 is involved in H2O2-induced PUMA gene expression and apoptosis in colorectal cancer cells.
18579560 2008 Sp1 and p73 activate PUMA following serum starvation.
18573879 2008 Selection against PUMA gene expression in Myc-driven B-cell lymphomagenesis.
18367875 2008 The BH3-only protein PUMA is involved in green tea polyphenol-induced apoptosis in colorectal cancer cell lines.
18354037 2008 BH3-only proteins Noxa, Bmf, and Bim are necessary for arsenic trioxide-induced cell death in myeloma.
18324703 2008 Puma is a novel target of soy isoflavone genistein but is dispensable for genistein-induced cell fate determination.
18215742 2008 PUMA inactivation protects against oxidative stress through p21/Bcl-XL inhibition of bax death.
17996028 2008 6-Hydroxydopamine activates the mitochondrial apoptosis pathway through p38 MAPK-mediated, p53-independent activation of Bax and PUMA.
17934815 2008 Expressional and mutational analysis of pro-apoptotic Bcl-2 member PUMA in hepatocellular carcinomas.
17698840 2007 Mcl-1 as a buffer for proapoptotic Bcl-2 family members during TRAIL-induced apoptosis: a mechanistic basis for sorafenib (Bay 43-9006)-induced TRAIL sensitization.
17616685 2007 The unhydrolyzable fenretinide analogue 4-hydroxybenzylretinone induces the proapoptotic genes GADD153 (CHOP) and Bcl-2-binding component 3 (PUMA) and apoptosis that is caspase- dependent and independent of the retinoic acid receptor.
17393317 2007 Pro-apoptotic PUMA and anti-apoptotic phospho-BAD are highly expressed in colorectal carcinomas.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17368424 2007 Involvement of up-regulation of PUMA in non-steroidal anti-inflammatory drug-induced apoptosis.
17360476 2007 The nuclear function of p53 is required for PUMA-mediated apoptosis induced by DNA damage.
17289999 2007 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.
17267315 2007 Immunohistochemical analysis of pro-apoptotic PUMA protein and mutational analysis of PUMA gene in gastric carcinomas.
17024184 2006 Differential contribution of Puma and Noxa in dual regulation of p53-mediated apoptotic pathways.
16983338 2007 Apoptosis induced by proteasome inhibition in cancer cells: predominant role of the p53/PUMA pathway.
16697956 2006 Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members.
16608847 2006 PUMA Dissociates Bax and Bcl-X(L) to induce apoptosis in colon cancer cells.
16462759 2006 Inhibition of Bax activity is crucial for the antiapoptotic function of the human papillomavirus E6 oncoprotein.
16407291 2006 Endoplasmic reticulum stress-induced apoptosis: multiple pathways and activation of p53-up-regulated modulator of apoptosis (PUMA) and NOXA by p53.
16151013 2005 PUMA couples the nuclear and cytoplasmic proapoptotic function of p53.
16091745 2005 BBC3 mediates fenretinide-induced cell death in neuroblastoma.
16007132 2005 Puma(*)Mcl-1 interaction is not sufficient to prevent rapid degradation of Mcl-1.
15905879 2005 Transcriptional upregulation of PUMA modulates endoplasmic reticulum calcium pool depletion-induced apoptosis via Bax activation.
15731089 2005 Degradation of the proapoptotic proteins Bik, Puma, and Bim with Bcl-2 domain 3 homology in Chlamydia trachomatis-infected cells.
15731037 2005 Broad degradation of proapoptotic proteins with the conserved Bcl-2 homology domain 3 during infection with Chlamydia trachomatis.
15694340 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function.
15595728 Large-scale quantitative proteomic study of PUMA-induced apoptosis using two-dimensional liquid chromatography-mass spectrometry coupled with amino acid-coded mass tagging.
15574335 2004 The first alpha helix of Bax plays a necessary role in its ligand-induced activation by the BH3-only proteins Bid and PUMA.
15547745 2004 mRNA and protein expression of PUMA in sporadic colorectal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143349 2004 HIV: no PUMA no death?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634023 2004 p73 Induces apoptosis via PUMA transactivation and Bax mitochondrial translocation.
14585351 2003 No PUMA, no death: implications for p53-dependent apoptosis.
14550297 2003 Bax conformational change is a crucial step for PUMA-mediated apoptosis in human leukemia.
12963126 2003 PUMA in head and neck cancer.
12574499 2003 PUMA mediates the apoptotic response to p53 in colorectal cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572983 2001 Expression of bbc3, a pro-apoptotic BH3-only gene, is regulated by diverse cell death and survival signals.
11463392 2001 PUMA, a novel proapoptotic gene, is induced by p53.
11463391 2001 PUMA induces the rapid apoptosis of colorectal cancer cells.