Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.24
PubTator Score 1.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (2)

AA Sequence

MASSAKSAEMPTISKTVNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSLPFLKNSSHQVTEQQTAQKFN      1 - 70
NLLKEIKDILKNMAGFEEKITEAKELFEETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEK     71 - 140
KQEMILETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQNSENTAQVFARDL    141 - 210
VNRLEEKKVLNETQQSQEKAKNRLNVQEETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKSQKDISE    211 - 280
TLGNNGVGFQTQPNNEVSAKHELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQ    281 - 350
EKPIQINYKQDKKNQKPSEAKKVEMYKQNKQAMKGTFWKKDRSCRSLDVCLNKKACNTQFNIHVARKALR    351 - 420
GKMRSASSLR                                                                421 - 430
//

Text Mined References (12)

PMID Year Title