Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.39
PubTator Score 3.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.253 1.4e-02
posterior fossa group B ependymoma 1.800 8.7e-06
psoriasis -1.400 1.0e-32

AA Sequence

MERVGCTLTTTYAHPRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVASNSPSVAPYCT      1 - 70
RSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQA     71 - 140
DTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDL    141 - 210
VHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDG    211 - 280
VGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNR    281 - 350
IAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRL    351 - 420
VNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGFC    421 - 490
//

Text Mined References (10)

PMID Year Title