Property Summary

NCBI Gene PubMed Count 26
PubMed Score 34.53
PubTator Score 24.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-06
Astrocytoma, Pilocytic -1.200 5.0e-09
atypical teratoid / rhabdoid tumor -1.500 8.4e-11
ependymoma -1.100 1.3e-12
group 4 medulloblastoma -1.700 6.2e-10
medulloblastoma, large-cell -1.900 5.7e-07
primitive neuroectodermal tumor -1.500 8.9e-07

Pathway (1)

Gene RIF (8)

AA Sequence

MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWR      1 - 70
EECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRA     71 - 140
QHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASA    141 - 210
ILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPS    211 - 280
RSSWLSTEGGRDSAQSPKLFTHKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQG    281 - 350
PVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHP    351 - 420
GEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRRSSLGEKGGPI    421 - 490
LGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLK    491 - 560
TVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYI    561 - 630
DRLLVRIMETSPTLLQIPPGPPK                                                   631 - 653
//

Text Mined References (32)

PMID Year Title