Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.88
PubTator Score 24.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
ependymoma 2514 1.34642186596641E-12
atypical teratoid / rhabdoid tumor 4369 8.4189257669338E-11
group 4 medulloblastoma 1875 6.1878158424324E-10
pilocytic astrocytoma 3086 4.56585651098303E-9
medulloblastoma, large-cell 6234 5.70820747267956E-7
primitive neuroectodermal tumor 3031 8.85339375355259E-7
adult high grade glioma 2148 2.36566318076567E-6
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 4.062 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.100 0.000
group 4 medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.500 0.000
adult high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000

Synonym

Accession Q9BXF6 O94939 Q9P0M1 Rab11-FIP5
Symbols GAF1
pp75
RIP11

Gene

  Ortholog (6)

Species Source
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (8)

PMID Text
24591568 FIP5-T276 phosphorylation occurs specifically during metaphase and anaphase.
21969467 FIP5-SNX18 complex plays a pivotal role in the polarized transport of apical proteins during apical lumen initiation in epithelial cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20717956 These data introduce Rab11b as a crucial regulator and Rip11 as mediator of acidosis-induced V-ATPase traffic in duct cells of submandibular gland.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18957512 Rip11/FIP5-kinesin-II complex plays a key role in the routing of internalized receptors through the perinuclear recycling endosomes.
18384058 analysis of the rearrangement breakpoints suggests that the reciprocal translocation may have formed secondary to incorrect repair of double strand breaks (DSBs) by nonhomologous end-joining (NHEJ).
17854769 These data therefore show that (i) Rab11a regulates cell surface abundance of both GLUT4 and FAT/CD36.

AA Sequence

MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWR      1 - 70
EECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRA     71 - 140
QHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASA    141 - 210
ILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPS    211 - 280
RSSWLSTEGGRDSAQSPKLFTHKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQG    281 - 350
PVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHP    351 - 420
GEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRRSSLGEKGGPI    421 - 490
LGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLK    491 - 560
TVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYI    561 - 630
DRLLVRIMETSPTLLQIPPGPPK                                                   631 - 653
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24591568 2014 FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040321 2013 The rab11 effector protein FIP1 regulates adiponectin trafficking and secretion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21969467 2011 Interaction between FIP5 and SNX18 regulates epithelial lumen formation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20717956 2011 Rab11b and its effector Rip11 regulate the acidosis-induced traffic of V-ATPase in salivary ducts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...