Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MASKDFAIGMILLSQIMVGFLGNFFLLYHYSFLCFTRGMLQSTDLILKHLTIANSLVILSKGIPQTMAAF      1 - 70
GLKDSLSDIGCKFVFYVHRVGRAVCVGNACLLSVFQVITISPSEFRWAELKLHAHKYIRSFILVLCWILN     71 - 140
TLVNITVLLHVTGKWNSINSTKTNDYGYCSGGSRSRIPHSLHIVLLSSLDVLCLGLMTLASGSMVFILHR    141 - 210
HKQQVQHIHGTNLSARSSPESRVTQSILVLVSTLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMV    211 - 280
SPFVLMSRHPRIPRLGSACCGRNPQFPKLVR                                           281 - 311
//

Text Mined References (4)

PMID Year Title
19952141 2010 Extreme variability among mammalian V1R gene families.
12826614 2003 Evolutionary deterioration of the vomeronasal pheromone transduction pathway in catarrhine primates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12123587 2002 Novel human vomeronasal receptor-like genes reveal species-specific families.