Property Summary

NCBI Gene PubMed Count 10
Grant Count 98
R01 Count 35
Funding $30,224,131.88
PubMed Score 1195.40
PubTator Score 125.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q9BXD5 B2R839 Q4G0Q8 Q4G0Z2 Q64L88 Q6PEL0 NALase
Symbols NAL
C112
NPL1
C1orf13

Gene

NPL

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
19057931 3D structure model of N-acetylneuraminate lyase from human (hNAL, EC 4.1.3.3) was created and refined
16147865 an NPL splice variant is mainly expressed in human liver, kidney and peripheral blood leukocytes

AA Sequence

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW      1 - 70
VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF     71 - 140
YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM    141 - 210
GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP    211 - 280
PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS                                  281 - 320
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22692205 2012 Metabolism of vertebrate amino sugars with N-glycolyl groups: elucidating the intracellular fate of the non-human sialic acid N-glycolylneuraminic acid.
19057931 2009 Homology modeling and molecular dynamics study on N-acetylneuraminate lyase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16147865 2005 A novel splice variant of human gene NPL, mainly expressed in human liver, kidney and peripheral blood leukocyte.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453637 2002 Characterization of a sialate pyruvate-lyase in the cytosol of human erythrocytes.
11737202 2001 The sialate-pyruvate lyase from pig kidney. Elucidation of the primary structure and expression of recombinant enzyme activity.
More...