Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1195.40
PubTator Score 125.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 1.07459733664882E-10
ovarian cancer 8492 5.4208329116849E-9
tuberculosis 1563 3.67110742945631E-5
invasive ductal carcinoma 2950 2.60325983316327E-4
osteosarcoma 7933 4.18734203587919E-4
ulcerative colitis 2087 7.14804896437319E-4
inflammatory breast cancer 404 0.00114336334373996
nasopharyngeal carcinoma 1056 0.00133571213566783
atypical teratoid/rhabdoid tumor 1095 0.0015219262120328
primary Sjogren syndrome 789 0.00199607604465827
glioblastoma 5572 0.00332664591064787
group 3 medulloblastoma 2254 0.0036443175535408
cutaneous lupus erythematosus 1056 0.00437868510484391
cystic fibrosis 1670 0.00463384908596229
medulloblastoma, large-cell 6234 0.00995972907505203
mucosa-associated lymphoid tissue lymphoma 480 0.012178073768711
nephrosclerosis 329 0.0131140341292362
subependymal giant cell astrocytoma 2287 0.0215304938332079
astrocytoma 1493 0.0431993798867616

Expression

  Differential Expression (19)

Synonym

Accession Q9BXD5 B2R839 Q4G0Q8 Q4G0Z2 Q64L88 Q6PEL0 NALase
Symbols NAL
C112
NPL1
C1orf13

Gene

NPL

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
19057931 3D structure model of N-acetylneuraminate lyase from human (hNAL, EC 4.1.3.3) was created and refined
16147865 an NPL splice variant is mainly expressed in human liver, kidney and peripheral blood leukocytes

AA Sequence

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW      1 - 70
VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF     71 - 140
YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM    141 - 210
GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP    211 - 280
PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS                                  281 - 320
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22692205 2012 Metabolism of vertebrate amino sugars with N-glycolyl groups: elucidating the intracellular fate of the non-human sialic acid N-glycolylneuraminic acid.
19057931 2009 Homology modeling and molecular dynamics study on N-acetylneuraminate lyase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16147865 2005 A novel splice variant of human gene NPL, mainly expressed in human liver, kidney and peripheral blood leukocyte.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453637 2002 Characterization of a sialate pyruvate-lyase in the cytosol of human erythrocytes.
11737202 2001 The sialate-pyruvate lyase from pig kidney. Elucidation of the primary structure and expression of recombinant enzyme activity.
More...