Property Summary

NCBI Gene PubMed Count 44
PubMed Score 693.89
PubTator Score 54.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Bardet-Biedl Syndrome 2 1 0.0 0.0
RETINITIS PIGMENTOSA 74 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.100 1.1e-10
medulloblastoma, large-cell -1.400 2.6e-04
oligodendroglioma 1.100 4.9e-02
osteosarcoma -1.348 6.5e-03
ovarian cancer -2.900 2.1e-10
posterior fossa group B ependymoma 1.100 2.2e-04
psoriasis -1.100 8.1e-11

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLN      1 - 70
INQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGG     71 - 140
NCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLC    141 - 210
PMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVI    211 - 280
FKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLL    281 - 350
ELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAE    351 - 420
GIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLD    421 - 490
PASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDD    491 - 560
IDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAED    561 - 630
ARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRD    631 - 700
AIRSNNINTLFKIMRVGTASS                                                     701 - 721
//

Text Mined References (47)

PMID Year Title