Property Summary

Ligand Count 10
NCBI Gene PubMed Count 12
PubMed Score 7.95
PubTator Score 8.00

Knowledge Summary

Patent (1,421)

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -2.200 3.8e-18
psoriasis 1.400 1.2e-18

Gene RIF (5)

AA Sequence

MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVL      1 - 70
SLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIA     71 - 140
GWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVL    141 - 210
SLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCL    211 - 280
ASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC                     281 - 333
//

Text Mined References (12)

PMID Year Title