Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.95
PubTator Score 8.00

Knowledge Summary

Patent (1,421)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.19004886164985E-18
lung carcinoma 2844 3.77540687166338E-18
Disease Target Count Z-score Confidence
Thyrotoxicosis 38 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -2.200 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9BXC1 Q2M3F7
Symbols FKSG79
GPCR17
LYPSR3

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (5)

PMID Text
25367286 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
25295623 We have demonstrated a significant association of this X chromosome-encoded immunoreceptor with autoimmune Addison's disease for the first time.
24289805 this study provides the first replication in a Caucasian population of the association between Graves' disease and the GPR174 rs3827440 single nucleotide polymorphism originally reported among Chinese.
23667180 The finding of an X-linked risk locus for Graves' disease expands our understanding of the role of the X chromosome in disease susceptibility.
23178570 These results suggested that GPR174 was a putative LysoPS receptor conjugating with Galpha(s), and its expression induced morphological changes in CHO cells by constitutively activating adenylyl cycles accompanied with cell conjunctions and delay of proliferation.

AA Sequence

MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVL      1 - 70
SLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIA     71 - 140
GWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVL    141 - 210
SLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCL    211 - 280
ASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC                     281 - 333
//

Text Mined References (12)

PMID Year Title
25367286 2015 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
25295623 2015 Role of the X-linked gene GPR174 in autoimmune Addison's disease.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
24289805 2014 rs3827440, a nonsynonymous single nucleotide polymorphism within GPR174 gene in X chromosome, is associated with Graves' disease in Polish Caucasian population.
23667180 2013 An X chromosome-wide association analysis identifies variants in GPR174 as a risk factor for Graves' disease.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
23178570 2013 Expression of orphan G-protein coupled receptor GPR174 in CHO cells induced morphological changes and proliferation delay via increasing intracellular cAMP.
20880198 2011 Quantitative expression profiling of G-protein-coupled receptors (GPCRs) in metastatic melanoma: the constitutively active orphan GPCR GPR18 as novel drug target.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...