Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.50
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
22906437 Data indicate that the apoB-100 secretion phenotype is replicated in HepG2 cells transduced with the ORP10 shRNA lentiviruses.
20610895 Single-nucleotide polymorphisms in OSBPL10 is associated with peripheral arterial disease.
20610895 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20224571 Overall, the rs2290532 (D254N) polymorphism in OSBPL10 may predispose individuals to hyper-LDL cholesterolemia.
20224571 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19554302 Analysis of variants in three genes encoding OSBP homologues in families with familial low high-density lipoprotein levels or familial combined hyperlipidemia revealed linkage of OSBPL10 single-nucleotide polymorphisms with high triglyceride trait.
19554302 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGSVAASPSGGGG      1 - 70
RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAIVSLSDEAPHMLV     71 - 140
VYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKSAPSSRSRSLTLLPHGTPNSASPCSQRHLSV    141 - 210
GAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKA    211 - 280
TSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAIL    281 - 350
PNSAEDEQTSQPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPT    351 - 420
FILEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCS    421 - 490
WEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYCECEEKRLCVNTHVWTK    491 - 560
SKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPWVELGGKVSINCAKTGYSATVIFHTKP    561 - 630
FYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRN    631 - 700
LWREVTRYLRLGDIDAATEQKRHLEEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH          701 - 764
//

Text Mined References (25)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24281739 2014 Is the gene-environment interaction paradigm relevant to genome-wide studies? The case of education and body mass index.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23934110 2013 Interactome map uncovers phosphatidylserine transport by oxysterol-binding proteins.
23325789 2013 cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22906437 2012 ORP10, a cholesterol binding protein associated with microtubules, regulates apolipoprotein B-100 secretion.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20610895 2010 Identification of evidence suggestive of an association with peripheral arterial disease at the OSBPL10 locus by genome-wide investigation in the Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...