Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.13
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.000 1.3e-03
ependymoma -2.300 1.7e-03
group 3 medulloblastoma -1.900 1.2e-02
intraductal papillary-mucinous adenoma (... 1.800 8.7e-03
intraductal papillary-mucinous carcinoma... 2.000 2.8e-03
intraductal papillary-mucinous neoplasm ... 2.900 4.6e-03
invasive ductal carcinoma 1.100 9.3e-03
lung cancer 1.300 2.3e-03
malignant mesothelioma 1.200 2.2e-06
nasopharyngeal carcinoma -1.200 7.9e-04
oligodendroglioma -2.000 1.0e-03
ovarian cancer 1.700 2.3e-03
pancreatic cancer 1.800 6.4e-06
pancreatic ductal adenocarcinoma liver m... 1.126 2.1e-02
pituitary cancer -2.400 1.9e-04
primary Sjogren syndrome 1.200 1.2e-02
spina bifida -2.406 3.6e-02
tuberculosis 1.400 3.5e-03

Gene RIF (8)

AA Sequence

MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGSVAASPSGGGG      1 - 70
RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAIVSLSDEAPHMLV     71 - 140
VYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKSAPSSRSRSLTLLPHGTPNSASPCSQRHLSV    141 - 210
GAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKA    211 - 280
TSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAIL    281 - 350
PNSAEDEQTSQPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPT    351 - 420
FILEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCS    421 - 490
WEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYCECEEKRLCVNTHVWTK    491 - 560
SKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPWVELGGKVSINCAKTGYSATVIFHTKP    561 - 630
FYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRN    631 - 700
LWREVTRYLRLGDIDAATEQKRHLEEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH          701 - 764
//

Text Mined References (25)

PMID Year Title