Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.03
PubTator Score 3.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.900 0.039
ependymoma 2.100 0.025
oligodendroglioma 1.800 0.023
osteosarcoma 3.125 0.000
medulloblastoma, large-cell -1.200 0.003
tuberculosis and treatment for 6 months -1.200 0.001
pancreatic ductal adenocarcinoma liver m... -1.055 0.004
Breast cancer 2.800 0.027
lung carcinoma -1.600 0.000
Pick disease 1.100 0.017
ovarian cancer 1.500 0.004
Down syndrome 1.500 0.002

Synonym

Accession Q9BXB4 A8K9I7 ORP-11
Symbols ORP11
ORP-11
OSBP12
TCCCIA00292

Gene

PDB

2D9X  

Gene RIF (6)

PMID Text
23028956 ORP8 overexpression resulted in reduced expression of the aP2 mRNA, while down-regulation of adiponectin and aP2 was observed in ORP11 silenced cells. ORP8 overexpression or silencing of ORP11 markedly decreased cellular triglyceride storage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20599956 The results identify ORP11 as an OSBP homologue distributing at the Golgi-LE interface and define the ORP9-ORP11 dimer as a functional unit that may act as an intracellular lipid sensor or transporter.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19325544 The OSBPL11 gene is involved in cholesterol and glucose metabolism in obese individuals.
19325544 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQGGEPVSTMKVSESEGKLEGQATAVTPNKNSSCGGGISSSSSSRGGSAKGWQYSDHMENVYGYLMKYTN      1 - 70
LVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDSHTFTVNAASGEQYKLRATDA     71 - 140
KERQHWVSRLQICTQHHTEAIGKNNPPLKSRSFSLASSSNSPISQRRPSQNAISFFNVGHSKLQSLSKRT    141 - 210
NLPPDHLVEVREMMSHAEGQQRDLIRRIECLPTSGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHA    211 - 280
SHQKGSLPSGTTIEWLEPKISLSNHYKNGADQPFATDQSKPVAVPEEQPVAESGLLAREPEEINADDEIE    281 - 350
DTCDHKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFIAITNGAT    351 - 420
AEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQGVTNHAPLSGE    421 - 490
SLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFLGMSIGVTMVGEGILSLLEHG    491 - 560
EEYTFSLPCAYARSILTVPWVELGGKVSVNCAKTGYSASITFHTKPFYGGKLHRVTAEVKHNITNTVVCR    561 - 630
VQGEWNSVLEFTYSNGETKYVDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL    631 - 700
EERQRTEERHRTETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPAE                           701 - 747
//

Text Mined References (28)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028956 2012 OSBP-related proteins (ORPs) in human adipose depots and cultured adipocytes: evidence for impacts on the adipocyte phenotype.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20599956 2010 OSBP-related protein 11 (ORP11) dimerizes with ORP9 and localizes at the Golgi-late endosome interface.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...