Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.03
PubTator Score 3.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.900 3.9e-02
Breast cancer 2.800 2.7e-02
Down syndrome 1.500 2.3e-03
ependymoma 2.100 2.5e-02
lung carcinoma -1.600 1.1e-19
medulloblastoma, large-cell -1.200 3.4e-03
oligodendroglioma 1.700 4.2e-02
osteosarcoma 3.125 5.0e-07
ovarian cancer 1.500 4.0e-03
pancreatic ductal adenocarcinoma liver m... -1.055 4.0e-03
Pick disease 1.100 1.7e-02
tuberculosis and treatment for 6 months -1.200 6.8e-04

 GO Function (1)

Gene RIF (6)

AA Sequence

MQGGEPVSTMKVSESEGKLEGQATAVTPNKNSSCGGGISSSSSSRGGSAKGWQYSDHMENVYGYLMKYTN      1 - 70
LVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDSHTFTVNAASGEQYKLRATDA     71 - 140
KERQHWVSRLQICTQHHTEAIGKNNPPLKSRSFSLASSSNSPISQRRPSQNAISFFNVGHSKLQSLSKRT    141 - 210
NLPPDHLVEVREMMSHAEGQQRDLIRRIECLPTSGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHA    211 - 280
SHQKGSLPSGTTIEWLEPKISLSNHYKNGADQPFATDQSKPVAVPEEQPVAESGLLAREPEEINADDEIE    281 - 350
DTCDHKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFIAITNGAT    351 - 420
AEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQGVTNHAPLSGE    421 - 490
SLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFLGMSIGVTMVGEGILSLLEHG    491 - 560
EEYTFSLPCAYARSILTVPWVELGGKVSVNCAKTGYSASITFHTKPFYGGKLHRVTAEVKHNITNTVVCR    561 - 630
VQGEWNSVLEFTYSNGETKYVDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL    631 - 700
EERQRTEERHRTETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPAE                           701 - 747
//

Text Mined References (28)

PMID Year Title