Property Summary

NCBI Gene PubMed Count 26
PubMed Score 61.35
PubTator Score 32.95

Knowledge Summary

Patent (6,748)

TINX Plot

  Disease Sources (5)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
non-small cell lung cancer 2798 7.00499798480233E-30
lung carcinoma 2844 8.05127262641397E-23
Breast cancer 3099 5.69113233548869E-9
malignant mesothelioma 3163 3.24938687089542E-8
psoriasis 6685 3.793355542958E-7
breast carcinoma 1614 1.22939408988997E-5
glioblastoma 5572 3.78546116465431E-5
atypical teratoid / rhabdoid tumor 4369 6.87229441060608E-5
lung adenocarcinoma 2714 1.26984996121705E-4
adult high grade glioma 2148 2.33495610081912E-4
interstitial cystitis 2299 0.00169246784602842
medulloblastoma, large-cell 6234 0.00369684295551502
lung cancer 4473 0.00656758982327469
aldosterone-producing adenoma 664 0.0209788044704685
adrenocortical carcinoma 1427 0.021265433303928
spina bifida 1064 0.0218452876494595
osteosarcoma 7933 0.0417458541326613
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
WAGR syndrome 12 3.047 1.5
Disease Target Count
Osteoporosis 259

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
psoriasis -1.100 0.000
osteosarcoma 1.115 0.042
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.800 0.004
adrenocortical carcinoma -1.039 0.021
non-small cell lung cancer 2.441 0.000
lung cancer 1.500 0.007
breast carcinoma -1.300 0.000
interstitial cystitis -1.800 0.002
lung adenocarcinoma 1.771 0.000
adult high grade glioma -1.700 0.000
aldosterone-producing adenoma -1.443 0.021
Breast cancer -2.500 0.000
lung carcinoma 1.900 0.000
spina bifida -1.495 0.022

Synonym

Accession Q9BXB1 A6NCH3 G5E9B3 Q8N537 Q9NYD1
Symbols GPR48
BNMD17

Gene

PANTHER Protein Class (1)

PDB

4KT1   4QXE   4QXF  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (18)

PMID Text
25636507 LGR4 promotes tumorigenesis of prostate cancer via PI3K/Akt signaling pathway.
25531322 These findings suggest that aberrant RSPO3-LGR4 signaling potentially acts as a driving mechanism in the aggressiveness of Keap1-deficient lung ADs.
25480784 the LGR4-Rspo1 complex crystal structure shows divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors
24639526 RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex.
24519938 Lgr4, which regulates eye, kidney, testis, ovary, and uterine organ development as well as mental development through genetic and epigenetic surveillance, is a novel candidate gene for the pathogenesis of AGR syndrome
24455684 our results suggest a previously unknown Stat3-LGR4 molecular network, which may control osteosarcoma development and progression
24212090 A functional low-frequency human LGR4 variant (A750T) has been associated with body mass index in a Chinese obese-versus-control study.
24083766 Lgr4 overexpression promoted glioma cell proliferation through activation of Wnt signaling.
24083742 GPR48 overexpression promotes cancer cell proliferation via activation of Wnt signaling.
23803691 Upregulation of GPR48 resulted in increased phosphorylation of glycogen synthase kinase 3beta.
More...

AA Sequence

MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNIT      1 - 70
QLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANH     71 - 140
ITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHN    141 - 210
NKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLY    211 - 280
DNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDL    281 - 350
SYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV    351 - 420
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQ    421 - 490
DHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVI    491 - 560
LTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGFLAVFSSE    561 - 630
SAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGE    631 - 700
TPSLGFTVTLVLLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAP    701 - 770
LITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD    771 - 840
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYAD    841 - 910
EEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD                                 911 - 951
//

Text Mined References (31)

PMID Year Title
25636507 2015 GPCR48/LGR4 promotes tumorigenesis of prostate cancer via PI3K/Akt signaling pathway.
25531322 2015 Aberrant RSPO3-LGR4 signaling in Keap1-deficient lung adenocarcinomas promotes tumor aggressiveness.
25480784 2015 Crystal structure of LGR4-Rspo1 complex: insights into the divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors (LGRs).
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
24519938 2014 LGR4/GPR48 inactivation leads to aniridia-genitourinary anomalies-mental retardation syndrome defects.
24455684 2013 Stat3 upregulates leucine-rich repeat-containing g protein-coupled receptor 4 expression in osteosarcoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24212090 2013 Ablation of LGR4 promotes energy expenditure by driving white-to-brown fat switch.
More...