Property Summary

NCBI Gene PubMed Count 37
PubMed Score 72.22
PubTator Score 32.95

Knowledge Summary

Patent (6,748)

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.039 2.1e-02
adult high grade glioma -1.700 2.3e-04
aldosterone-producing adenoma -1.443 2.1e-02
atypical teratoid / rhabdoid tumor -1.200 6.9e-05
Breast cancer -2.500 5.7e-09
breast carcinoma -1.300 1.2e-05
glioblastoma -1.300 3.8e-05
interstitial cystitis -1.800 1.7e-03
lung adenocarcinoma 1.400 1.3e-14
lung cancer -1.100 2.1e-03
lung carcinoma 1.900 8.1e-23
malignant mesothelioma -2.400 3.2e-08
medulloblastoma, large-cell -1.800 3.7e-03
non-small cell lung cancer 2.441 7.0e-30
osteosarcoma 1.115 4.2e-02
psoriasis -1.100 3.8e-07
spina bifida -1.495 2.2e-02

Protein-protein Interaction (5)

Gene RIF (28)

AA Sequence

MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNIT      1 - 70
QLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANH     71 - 140
ITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHN    141 - 210
NKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLY    211 - 280
DNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDL    281 - 350
SYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV    351 - 420
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQ    421 - 490
DHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVI    491 - 560
LTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGFLAVFSSE    561 - 630
SAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGE    631 - 700
TPSLGFTVTLVLLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAP    701 - 770
LITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD    771 - 840
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYAD    841 - 910
EEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD                                 911 - 951
//

Text Mined References (42)

PMID Year Title