Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.10
PubTator Score 8.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
astrocytoma 1493 5.07208592322949E-13
posterior fossa group B ependymoma 1530 1.75653927804638E-7
oligodendroglioma 2849 1.21808805666454E-5
psoriasis 6685 8.17617058401934E-5
glioblastoma 5572 5.16380967411804E-4
group 3 medulloblastoma 2254 0.00126498684132692
medulloblastoma, large-cell 6234 0.00301566898314461
interstitial cystitis 2299 0.00994985764540158
pediatric high grade glioma 2712 0.0105191208771831
primitive neuroectodermal tumor 3031 0.0197644081513587
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.600 0.000
glioblastoma 1.900 0.001
oligodendroglioma 1.100 0.000
posterior fossa group B ependymoma -2.400 0.000
group 3 medulloblastoma -2.900 0.001
medulloblastoma, large-cell -2.400 0.003
primitive neuroectodermal tumor 1.700 0.020
interstitial cystitis -1.300 0.010
pediatric high grade glioma 1.600 0.011
psoriasis -1.100 0.000

Synonym

Accession Q9BXA9 Q9UGH1
Symbols ZNF796

Gene

  Ortholog (10)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
22690083 sall3 shows aberrant methylation and downregulation in human hepatocellular carcinoma
20634891 Observational study of gene-disease association. (HuGE Navigator)
19247946 Studies indicate that vertebrate sal orthologues (spalt-like/sall) have important developmental roles during neural development and organogenesis and gentic diseases.
19139273 This functional characterization of SALL3 sheds light on regulatory mechanisms for DNMT3A and provides new strategies to inhibit aberrant methylation in cancer.

AA Sequence

MSRRKQAKPQHLKSDEELLPPDGAPEHAAPGEGAEDADSGPESRSGGEETSVCEKCCAEFFKWADFLEHQ      1 - 70
RSCTKLPPVLIVHEDAPAPPPEDFPEPSPASSPSERAESEAAEEAGAEGAEGEARPVEKEAEPMDAEPAG     71 - 140
DTRAPRPPPAAPAPPTPAYGAPSTNVTLEALLSTKVAVAQFSQGARAAGGSGAGGGVAAAAVPLILEQLM    141 - 210
ALQQQQIHQLQLIEQIRSQVALMQRPPPRPSLSPAAAPSAPGPAPSQLPGLAALPLSAGAPAAAIAGSGP    211 - 280
AAPAAFEGAQPLSRPESGASTPGGPAEPSAPAAPSAAPAPAAPAPAPAPQSAASSQPQSASTPPALAPGS    281 - 350
LLGAAPGLPSPLLPQTSASGVIFPNPLVSIAATANALDPLSALMKHRKGKPPNVSVFEPKASAEDPFFKH    351 - 420
KCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEKYPHIQMNPYPVPEYLDN    421 - 490
VPTCSGIPYGMSLPPEKPVTTWLDSKPVLPTVPTSVGLQLPPTVPGAHGYADSPSATPASRSPQRPSPAS    491 - 560
SECASLSPGLNHVESGVSATAESPQSLLGGPPLTKAEPVSLPCTNARAGDAPVGAQASAAPTSVDGAPTS    561 - 630
LGSPGLPAVSEQFKAQFPFGGLLDSMQTSETSKLQQLVENIDKKMTDPNQCVICHRVLSCQSALKMHYRT    631 - 700
HTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQHIRMHMGGQIPNTP    701 - 770
LPEGFQDAMDSELAYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSI    771 - 840
AALENQMKMIDSVMSCQQLTGLKSVENGSGESDRLSNDSSSAVGDLESRSAGSPALSESSSSQALSPAPS    841 - 910
NGESFRSKSPGLGAPEEPQEIPLKTERPDSPAAAPGSGGAPGRAGIKEEAPFSLLFLSRERGKCPSTVCG    911 - 980
VCGKPFACKSALEIHYRSHTKERPFVCALCRRGCSTMGNLKQHLLTHRLKELPSQLFDPNFALGPSQSTP    981 - 1050
SLISSAAPTMIKMEVNGHGKAMALGEGPPLPAGVQVPAGPQTVMGPGLAPMLAPPPRRTPKQHNCQSCGK   1051 - 1120
TFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNAPARRGRRLSVENPMALLGGDAL   1121 - 1190
KFSEMFQKDLAARAMNVDPSFWNQYAAAITNGLAMKNNEISVIQNGGIPQLPVSLGGSALPPLGSMASGM   1191 - 1260
DKARTGSSPPIVSLDKASSETAASRPFTRFIEDNKEIGIN                                 1261 - 1300
//

Text Mined References (14)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22690083 2012 Aberrant methylation and downregulation of sall3 in human hepatocellular carcinoma.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19247946 2009 Regulation and function of Spalt proteins during animal development.
19139273 2009 SALL3 interacts with DNMT3A and shows the ability to inhibit CpG island methylation in hepatocellular carcinoma.
18668548 2008 Genome-wide association study of rheumatoid arthritis in the Spanish population: KLF12 as a risk locus for rheumatoid arthritis susceptibility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...