Property Summary

NCBI Gene PubMed Count 10
PubMed Score 23.08
PubTator Score 5.26

Knowledge Summary

Patent (1,884)

TINX Plot

  Disease Sources (2)

Expression

Synonym

Accession Q9BXA7 B2R8D9 TSK-1
Symbols TSK1
TSSK1
FKSG81
SPOGA4
STK22D

Gene

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
23258646 Report evolution of testis-specific kinases TSSK1B and TSSK2 in primates.

AA Sequence

MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC      1 - 70
SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD     71 - 140
NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP    211 - 280
SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST    281 - 350
METEEGPPQQPPETRAQ                                                         351 - 367
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23258646 2013 Evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
20729278 2011 Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
19530700 2009 Identification of peptide substrate and small molecule inhibitors of testis-specific serine/threonine kinase1 (TSSK1) by the developed assays.
17566264 2007 Validation of a testis specific serine/threonine kinase [TSSK] family and the substrate of TSSK1 & 2, TSKS, as contraceptive targets.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...