Property Summary

NCBI Gene PubMed Count 10
Grant Count 17
R01 Count 5
Funding $1,286,456.15
PubMed Score 23.08
PubTator Score 5.26

Knowledge Summary

Patent (1,884)

TINX Plot

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
23258646 Report evolution of testis-specific kinases TSSK1B and TSSK2 in primates.

AA Sequence

MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC      1 - 70
SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD     71 - 140
NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP    211 - 280
SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST    281 - 350
METEEGPPQQPPETRAQ                                                         351 - 367
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23258646 2013 Evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
20729278 2011 Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
19530700 2009 Identification of peptide substrate and small molecule inhibitors of testis-specific serine/threonine kinase1 (TSSK1) by the developed assays.
17566264 2007 Validation of a testis specific serine/threonine kinase [TSSK] family and the substrate of TSSK1 & 2, TSKS, as contraceptive targets.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...