Property Summary

Ligand Count 4
NCBI Gene PubMed Count 10
PubMed Score 24.20
PubTator Score 5.26

Knowledge Summary

Patent (1,884)

TINX Plot

Gene RIF (1)

AA Sequence

MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC      1 - 70
SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD     71 - 140
NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP    211 - 280
SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST    281 - 350
METEEGPPQQPPETRAQ                                                         351 - 367
//

Text Mined References (15)

PMID Year Title