Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 8
Funding $552,346.4
PubMed Score 18.49
PubTator Score 3.63

Knowledge Summary

Patent (1,635)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.300 0.000

Gene RIF (3)

PMID Text
20037600 findings, for the first time, suggested an association of c.822+126T>G/C in TSSK6 with spermatogenic impairment in humans in which allele T may be a risk factor for male infertility, while alleles C and G may decrease susceptibility to male infertility
20037600 Observational study of gene-disease association. (HuGE Navigator)
15870294 results demonstrate that SSTK is required for proper postmeiotic chromatin remodeling and male fertility

AA Sequence

MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHP      1 - 70
HIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCEN     71 - 140
VLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCM    141 - 210
PFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG           211 - 273
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20829357 2010 Identification of a novel HSP70-binding cochaperone critical to HSP90-mediated activation of small serine/threonine kinase.
20037600 2010 c.822+126T>G/C: a novel triallelic polymorphism of the TSSK6 gene associated with spermatogenic impairment in a Chinese population.
15870294 2005 Identification and characterization of SSTK, a serine/threonine protein kinase essential for male fertility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044604 2004 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...