Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.49
PubTator Score 3.63

Knowledge Summary

Patent (1,635)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
adult high grade glioma 2148 1.33763979783709E-4
medulloblastoma, large-cell 6234 1.50412734639369E-4
Disease Target Count Z-score Confidence
Oligospermia 30 5.027 2.5
Supraglottis cancer 2 4.059 2.0
Azoospermia 89 3.92 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.300 0.000

Synonym

Accession Q9BXA6 B2R9F8 Q6ZMC4 Q96LJ4 TSK-6
Symbols CT72
SSTK
TSSK4
FKSG82

Gene

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

 Collection (1)

Gene RIF (3)

PMID Text
20037600 findings, for the first time, suggested an association of c.822+126T>G/C in TSSK6 with spermatogenic impairment in humans in which allele T may be a risk factor for male infertility, while alleles C and G may decrease susceptibility to male infertility
20037600 Observational study of gene-disease association. (HuGE Navigator)
15870294 results demonstrate that SSTK is required for proper postmeiotic chromatin remodeling and male fertility

AA Sequence

MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHP      1 - 70
HIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCEN     71 - 140
VLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCM    141 - 210
PFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG           211 - 273
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20829357 2010 Identification of a novel HSP70-binding cochaperone critical to HSP90-mediated activation of small serine/threonine kinase.
20037600 2010 c.822+126T>G/C: a novel triallelic polymorphism of the TSSK6 gene associated with spermatogenic impairment in a Chinese population.
15870294 2005 Identification and characterization of SSTK, a serine/threonine protein kinase essential for male fertility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044604 2004 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...