Property Summary

NCBI Gene PubMed Count 11
PubMed Score 22.24
PubTator Score 3.63

Knowledge Summary

Patent (1,635)

TINX Plot

  Disease (3)

Disease Target Count P-value
adult high grade glioma 3801 1.3e-04
medulloblastoma, large-cell 6241 3.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Oligospermia 36 4.987 2.5
Supraglottis cancer 1 4.007 2.0
Azoospermia 110 3.852 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-04
medulloblastoma, large-cell -1.100 3.9e-04

Gene RIF (3)

AA Sequence

MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHP      1 - 70
HIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCEN     71 - 140
VLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCM    141 - 210
PFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG           211 - 273
//

Text Mined References (11)

PMID Year Title