Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
R01 Count 3
Funding $361,860
PubMed Score 37.48
PubTator Score 18.79

Knowledge Summary

Patent (2,891)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 2.400 0.005
pancreatic cancer 1.500 0.003
interstitial cystitis 1.200 0.011
lung carcinoma -1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q9BXA5 A8K305 Q8TDQ8
Symbols GPR91

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (10)

PMID Text
26824665 The findings indicate that succinate-GPR91 signaling may be involved in right ventricular hypertrophy via PI3K/Akt signaling in vivo and in vitro.
26759054 Through GPR91, succinate is involved in functions such as regulation of blood pressure, inhibition of lipolysis in white adipose tissue, development of retinal vascularization and cardiac hypertrophy. [review]
26051274 results show that succinate plays an important role in HSC activation through GPR91 induction, and suggest that succinate and GPR91 may represent new therapeutic targets for modulating hepatic fibrosis
25539979 These results show for the first time that succinate plays an important role in cardiomyocyte hypertrophy through GPR91 activation and extend our understanding of how ischemia can induce hypertrophic cardiomyopathy
23833031 These findings suggest that deficiency in SUCNR1 is a possible contributing factor to the pathogenesis of dry age-related macular degeneration.
23770096 results show that GPR91 when expressed in HEK293s cells couples exclusively through the Galphai pathway and acts through Galphai not only to inhibit cAMP production but also to increase intracellular Ca(2+)
22497252 A review of how neuron-derived factors, GPR91 and Semaphorin 3A, guide retinal vascularization and are major contributors to the pathogenesis of retinopathy of prematurity .
19204147 Succinate stimulates cell proliferation through GPR91 and requires activation of the Erk MAPK pathway.
15141213 This paper describes function in another species.
15141213 GPR91 is a receptor for succinate and mediates succinate-induced hypertension.

AA Sequence

MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDL      1 - 70
AFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAI     71 - 140
LISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI    141 - 210
ALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVT    211 - 280
RPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK                    281 - 334
//

Text Mined References (18)

PMID Year Title
26824665 2016 The Succinate Receptor GPR91 Is Involved in Pressure Overload-Induced Ventricular Hypertrophy.
26759054 2016 GPR91: expanding the frontiers of Krebs cycle intermediates.
26051274 2015 Succinate causes ?-SMA production through GPR91 activation in hepatic stellate cells.
25539979 2014 Succinate causes pathological cardiomyocyte hypertrophy through GPR91 activation.
23833031 2013 Deficiency in the metabolite receptor SUCNR1 (GPR91) leads to outer retinal lesions.
23770096 2013 Succinate receptor GPR91, a G?(i) coupled receptor that increases intracellular calcium concentrations through PLC?.
22497252 2012 Neovascularization in retinopathy of prematurity: opposing actions of neuronal factors GPR91 and semaphorins 3A.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
19204147 2009 The role of the GPR91 ligand succinate in hematopoiesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...