Property Summary

Ligand Count 7
NCBI Gene PubMed Count 20
PubMed Score 44.36
PubTator Score 18.79

Knowledge Summary

Patent (2,891)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.400 4.6e-03
lung carcinoma -1.200 1.5e-09
ovarian cancer -1.100 2.1e-05
pancreatic cancer 1.500 3.0e-03

Gene RIF (14)

AA Sequence

MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDL      1 - 70
AFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAI     71 - 140
LISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI    141 - 210
ALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVT    211 - 280
RPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK                    281 - 334
//

Text Mined References (22)

PMID Year Title