Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 5
Funding $2,166,826.67
PubMed Score 166.23
PubTator Score 115.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma 1.200 0.005
Barrett's esophagus 1.200 0.043
esophageal adenocarcinoma 1.100 0.018
interstitial cystitis 1.400 0.001
group 3 medulloblastoma 1.200 0.008
pilocytic astrocytoma 1.100 0.001
posterior fossa group A ependymoma 1.100 0.000
pterygium 1.200 0.005
ulcerative colitis 1.300 0.000

Gene RIF (6)

PMID Text
22627768 The molecule recognized by PAL-E and anti-PV-1 antibodies is not NRP-1 but PV-1.
21827737 These results suggest that PV1 protein is able to block SV40 infectivity at low but not at high viral concentration either by interfering with the infective internalization pathway at the cell surface or at a post internalization step.
20979949 Case Report: Suggest activated platelets, enhanced coagulation state, glomerular expression of PV-1 and endothelial damage may contribute to glomerulonephropathy associated with polycythemia vera.
19420356 leukocyte transendothelial migration is the first known function for PV-1
16278383 Plasmalemmal vesicle associated protein-1 has a role in brain tumor angiogenesis
15155804 PV1 is a key structural component, necessary for the biogenesis of the stomatal and fenestral diaphragms.

AA Sequence

MGLAMEHGGSYARAGGSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAEGL      1 - 70
YSQLLGLTASQSNLTKELNFTTRAKDAIMQMWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSE     71 - 140
KQCRDQFKDMNKSCDALLFMLNQKVKTLEVEIAKEKTICTKDKESVLLNKRVAEEQLVECVKTRELQHQE    141 - 210
RQLAKEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMS    211 - 280
SKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSRQTQLALEE    281 - 350
KAVLRKERDNLAKELEEKKREAEQLRMELAIRNSALDTCIKTKSQPMMPVSRPMGPVPNPQPIDPASLEE    351 - 420
FKRKILESQRPPAGIPVAPSSG                                                    421 - 442
//

Text Mined References (17)

PMID Year Title
22627768 2012 PV-1 is recognized by the PAL-E antibody and forms complexes with NRP-1.
21827737 2011 Plasmalemmal vesicle associated protein (PV1) modulates SV40 virus infectivity in CV-1 cells.
20979949 2010 Histopathological manifestations of membranoproliferative glomerulonephritis and glomerular expression of plasmalemmal vesicle-associated protein-1 in a patient with polycythemia vera.
19420356 2009 The prototype endothelial marker PAL-E is a leukocyte trafficking molecule.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16278383 2005 Plasmalemmal vesicle associated protein-1 is a novel marker implicated in brain tumor angiogenesis.
15971170 2005 Plasmalemmal vesicle-associated protein (PLVAP) is expressed by tumour endothelium and is upregulated by vascular endothelial growth factor-A (VEGF).
More...