Property Summary

NCBI Gene PubMed Count 20
PubMed Score 195.88
PubTator Score 115.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.0e-03
Barrett's esophagus 1.200 4.3e-02
esophageal adenocarcinoma 1.100 1.8e-02
group 3 medulloblastoma 1.200 8.2e-03
interstitial cystitis 1.400 1.4e-03
posterior fossa group A ependymoma 1.100 2.1e-04
pterygium 1.200 5.3e-03
ulcerative colitis 1.300 2.7e-04
urothelial carcinoma 1.200 5.3e-03

 CSPA Cell Line (2)

Protein-protein Interaction (5)

Gene RIF (10)

AA Sequence

MGLAMEHGGSYARAGGSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAEGL      1 - 70
YSQLLGLTASQSNLTKELNFTTRAKDAIMQMWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSE     71 - 140
KQCRDQFKDMNKSCDALLFMLNQKVKTLEVEIAKEKTICTKDKESVLLNKRVAEEQLVECVKTRELQHQE    141 - 210
RQLAKEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMS    211 - 280
SKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSRQTQLALEE    281 - 350
KAVLRKERDNLAKELEEKKREAEQLRMELAIRNSALDTCIKTKSQPMMPVSRPMGPVPNPQPIDPASLEE    351 - 420
FKRKILESQRPPAGIPVAPSSG                                                    421 - 442
//

Text Mined References (21)

PMID Year Title