Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.89
PubTator Score 10.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
osteosarcoma 3.469 0.000
chronic lymphosyte leukemia 2.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.566 0.006
colon cancer -1.300 0.003
Breast cancer 2.000 0.042
primary Sjogren syndrome 1.400 0.003
aldosterone-producing adenoma -1.756 0.028
Pick disease -1.300 0.000
ovarian cancer -2.400 0.000
Down syndrome 1.100 0.001
head and neck cancer and chronic obstruc... 1.100 0.003

Synonym

Accession Q9BX95 B2RAH0 Q9H189 SPPase1
Symbols SPPase1

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
26239167 The two gastric cancer cells transfected with pEF-SGPP1 exhibited a slower rate of growth with less adhesion. Thus, our findings provided evidence that SGPP1 may serve as a prognostic biomarker for patients with advanced gastric cancers.
25166914 Study has revealed miR-27a as a tumor suppressor and has identified SGPP1 and Smad2 as novel targets of miR-27a, linking to STAT3 for regulating cancer cell proliferation, apoptosis and migration in colorectal cancer.
24145350 The sphingolipid phosphatase SGPP1, an antagonist of sphingosine-1-phosphate signaling, is a target of miR-95 that promotes radiation resistance.
22106015 S1P is elevated in patients with IPF, correlates with the lung function and mediates EMT.
22052905 doxorubicin switches protective autophagy in SPP1-depleted cells to apoptosis by calpain-mediated Atg5 cleavage.
21940944 Under normal circumstances, the retinal vascular pericytes maintain pericyte-endothelial contacts and vascular barrier function through the secretion of sphingosine 1-phosphate.
20798685 SPP1 by regulating intracellular S1P homeostasis, can control the UPR and ER stress-induced autophagy.
17895250 Sphingosine kinase 2, but not sphingosine kinase 1, acted in concert with SPP-1 to regulate recycling of sphingosine into ceramide.
16782891 SPP-1 regulates ceramide levels in the ER and thus influences the anterograde membrane transport of both ceramide and proteins from the ER to the Golgi apparatus.
15180992 sphingosine-1-phosphate phosphatase 1 has a role in epidermal growth factor-induced chemotaxis
More...

AA Sequence

MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKAEAPLAGDPRLRGRQPGAPGGPQPPG      1 - 70
SDRNQCPAKPDGGGAPNGVRNGLAAELGPASPRRAGALRRNSLTGEEGQLARVSNWPLYCLFCFGTELGN     71 - 140
ELFYILFFPFWIWNLDPLVGRRLVVIWVLVMYLGQCTKDIIRWPRPASPPVVKLEVFYNSEYSMPSTHAM    141 - 210
SGTAIPISMVLLTYGRWQYPLIYGLILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDL    211 - 280
IDNFNQTHKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMGLVLDPSLDTL    281 - 350
PLAGPPITVTLFGKAILRILIGMVFVLIIRDVMKKITIPLACKIFNIPCDDIRKARQHMEVELPYRYITY    351 - 420
GMVGFSITFFVPYIFFFIGIS                                                     421 - 441
//

Text Mined References (29)

PMID Year Title
26239167 2015 Inhibition of sphingosine-1-phosphate phosphatase 1 promotes cancer cells migration in gastric cancer: Clinical implications.
25166914 2014 Tumor suppressor microRNA-27a in colorectal carcinogenesis and progression by targeting SGPP1 and Smad2.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145350 2013 miRNA-95 mediates radioresistance in tumors by targeting the sphingolipid phosphatase SGPP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22106015 2012 Sphingosine-1-phosphate is increased in patients with idiopathic pulmonary fibrosis and mediates epithelial to mesenchymal transition.
22052905 2011 Autophagy induced by deficiency of sphingosine-1-phosphate phosphohydrolase 1 is switched to apoptosis by calpain-mediated autophagy-related gene 5 (Atg5) cleavage.
21940944 2011 Pericyte-derived sphingosine 1-phosphate induces the expression of adhesion proteins and modulates the retinal endothelial cell barrier.
More...