Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.54
PubTator Score 10.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.756 2.8e-02
Breast cancer 2.000 4.2e-02
chronic lymphosyte leukemia 2.000 1.3e-09
colon cancer -1.300 3.1e-03
Down syndrome 1.100 1.4e-03
head and neck cancer and chronic obstruc... 1.100 2.6e-03
malignant mesothelioma -1.600 1.0e-04
osteosarcoma 3.469 9.6e-06
ovarian cancer -2.400 8.1e-05
pancreatic ductal adenocarcinoma liver m... -1.566 5.7e-03
Pick disease -1.300 4.8e-04
primary Sjogren syndrome 1.400 2.5e-03

Gene RIF (11)

AA Sequence

MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKAEAPLAGDPRLRGRQPGAPGGPQPPG      1 - 70
SDRNQCPAKPDGGGAPNGVRNGLAAELGPASPRRAGALRRNSLTGEEGQLARVSNWPLYCLFCFGTELGN     71 - 140
ELFYILFFPFWIWNLDPLVGRRLVVIWVLVMYLGQCTKDIIRWPRPASPPVVKLEVFYNSEYSMPSTHAM    141 - 210
SGTAIPISMVLLTYGRWQYPLIYGLILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDL    211 - 280
IDNFNQTHKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMGLVLDPSLDTL    281 - 350
PLAGPPITVTLFGKAILRILIGMVFVLIIRDVMKKITIPLACKIFNIPCDDIRKARQHMEVELPYRYITY    351 - 420
GMVGFSITFFVPYIFFFIGIS                                                     421 - 441
//

Text Mined References (31)

PMID Year Title