Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.94
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 2.7e-02
pancreatic ductal adenocarcinoma liver m... -2.228 5.4e-04
ulcerative colitis -1.400 3.6e-06

Synonym

Accession Q9BX93 B7ZL23 Q52LB2 Q96Q99
Symbols GXIIB
FKSG71
PLA2G13
GXIIIsPLA2
sPLA2-GXIIB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRY      1 - 70
GKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSI     71 - 140
CSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL                   141 - 195
//

Text Mined References (15)

PMID Year Title