Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $31,737
PubMed Score 4.01
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (4)

PMID Text
19817957 Observational study of gene-disease association. (HuGE Navigator)
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRY      1 - 70
GKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSI     71 - 140
CSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL                   141 - 195
//

Text Mined References (14)

PMID Year Title
25201034 2014 Gene profiling of human VEGF signaling pathways in human endothelial and retinal pigment epithelial cells after anti VEGF treatment.
24173221 2014 Hepatocyte nuclear factor 4? and downstream secreted phospholipase A2 GXIIB regulate production of infectious hepatitis C virus.
22909802 2012 Conservation of group XII phospholipase A2 from bacteria to human.
21274867 2011 Hepatocyte nuclear factor-4 alpha regulates liver triglyceride metabolism in part through secreted phospholipase A? GXIIB.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19541351 2009 Lung mast cells are a source of secreted phospholipases A2.
18212756 2008 Distinct expression pattern of the full set of secreted phospholipases A2 in human colorectal adenocarcinomas: sPLA2-III as a biomarker candidate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15863368 2005 Time-resolved fluoroimmunoassays of the complete set of secreted phospholipases A2 in human serum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...