Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.29
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -2.000 8.2e-09
colon cancer -1.100 1.1e-02
glioblastoma -1.100 1.8e-02
intraductal papillary-mucinous carcinoma... -1.100 2.4e-02
invasive ductal carcinoma -1.300 4.3e-05
medulloblastoma, large-cell -1.800 1.0e-03
osteosarcoma -1.386 1.0e-02
ovarian cancer -1.800 3.8e-09
progressive supranuclear palsy -1.100 1.4e-02
psoriasis -1.100 9.7e-33

Gene RIF (1)

AA Sequence

MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKPYVISLLEQGR      1 - 70
EPWEMTSEMTRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEM     71 - 140
FSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNE    141 - 210
CDKTFTHSSSLTVHFRIHTGEKPYACEECGKAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQH    211 - 280
QRIHTGEKPYKCKECRKAFRQPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIE    281 - 350
CGKAFRYNTSFIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCGVCGKTFSSGSSRTV    351 - 420
HQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRIHTGEKPYECK    421 - 490
ECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGEKPYECNECGKAFSQTSNLTQ    491 - 560
HQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQCFECGKAFRRKLSLICHQRSHTGEEP        561 - 626
//

Text Mined References (14)

PMID Year Title