Property Summary

NCBI Gene PubMed Count 31
Grant Count 32
R01 Count 12
Funding $2,726,142.26
PubMed Score 61.14
PubTator Score 42.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.267 0.001
medulloblastoma, large-cell 1.100 0.001

Gene RIF (21)

PMID Text
26373900 A novel mutation in two Hmong families broadens the range of STRA6-related malformations to include contractures and camptodactyly.
25237067 These data establish that holo-RBP and its receptor STRA6 are potent oncogenes and suggest that the pathway is a novel target for therapy of some human cancers.
24284421 STRA6 has a role for regulating retinoid homeostasis and in helping to program signaling that drives proliferation and differentiation of human skin cells
24223695 Evidence for the existence of a transmembrane pore, analogous to the pore of ion channels, in STRA6.
23449393 Stra6, a retinoic acid-responsive gene, participates in p53-induced apoptosis after DNA damage.
22826435 TTR blocks the ability of holo-retinol-binding protein to associate with STRA6 and thereby effectively suppresses both STRA6-mediated retinol uptake and STRA6-initiated cell signaling.
22686418 Findings suggest that heterozygosity for the STRA6 gene mutation may be associated with ocular abnormalities.
22665496 STRA6 orchestrates a multicomponent machinery that couples vitamin A homeostasis and metabolism to activation of a signaling cascade and that, in turn, STRA6 signaling regulates the cellular uptake of the vitamin.
22283518 Analysis of FRAS1 and STRA6 mutations in the same family with eye anomalies.
21901792 STRA6 mutations can cause isolated eye malformations in addition to the congenital anomalies observed in MWS.
More...

AA Sequence

MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPGLYHACLASLSILVLLLLAML      1 - 70
VRRRQLWPDCVRGRPGLPSPVDFLAGDRPRAVPAAVFMVLLSSLCLLLPDEDALPFLTLASAPSQDGKTE     71 - 140
APRGAWKILGLFYYAALYYPLAACATAGHTAAHLLGSTLSWAHLGVQVWQRAECPQVPKIYKYYSLLASL    141 - 210
PLLLGLGFLSLWYPVQLVRSFSRRTGAGSKGLQSSYSEEYLRNLLCRKKLGSSYHTSKHGFLSWARVCLR    211 - 280
HCIYTPQPGFHLPLKLVLSATLTGTAIYQVALLLLVGVVPTIQKVRAGVTTDVSYLLAGFGIVLSEDKQE    281 - 350
VVELVKHHLWALEVCYISALVLSCLLTFLVLMRSLVTHRTNLRALHRGAALDLSPLHRSPHPSRQAIFCW    351 - 420
MSFSAYQTAFICLGLLVQQIIFFLGTTALAFLVLMPVLHGRNLLLFRSLESSWPFWLTLALAVILQNMAA    421 - 490
HWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLD    491 - 560
PGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARP    561 - 630
GASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP                                     631 - 667
//

Text Mined References (34)

PMID Year Title
26373900 2016 A novel mutation in two Hmong families broadens the range of STRA6-related malformations to include contractures and camptodactyly.
25237067 2014 Holo-retinol-binding protein and its receptor STRA6 drive oncogenic transformation.
24284421 2014 Downregulation of STRA6 expression in epidermal keratinocytes leads to hyperproliferation-associated differentiation in both in vitro and in vivo skin models.
24223695 2013 Vitamin A transport and the transmembrane pore in the cell-surface receptor for plasma retinol binding protein.
23449393 2013 Stra6, a retinoic acid-responsive gene, participates in p53-induced apoptosis after DNA damage.
22826435 2012 Transthyretin blocks retinol uptake and cell signaling by the holo-retinol-binding protein receptor STRA6.
22686418 2013 Mutation analysis of the STRA6 gene in isolated and non-isolated anophthalmia/microphthalmia.
22665496 2012 Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6.
22283518 2013 A puzzle over several decades: eye anomalies with FRAS1 and STRA6 mutations in the same family.
21901792 2011 First implication of STRA6 mutations in isolated anophthalmia, microphthalmia, and coloboma: a new dimension to the STRA6 phenotype.
More...