Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.53
PubTator Score 6.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEP      1 - 70
VNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFY     71 - 140
LGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP       141 - 207
//

Text Mined References (8)

PMID Year Title