Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.08
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.2e-05
glioblastoma 1.400 1.9e-05
interstitial cystitis -1.100 1.7e-02
medulloblastoma, large-cell 1.100 8.1e-04

Gene RIF (4)

AA Sequence

MAAGGSGGRASCPPGVGVGPGTGGSPGPSANAAATPAPGNAAAAAAAAAAAAAAPGPTPPAPPGPGTDAQ      1 - 70
AAGAERAEEAAGPGAAALQREAAYNWQASKPTVQERFAFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLA     71 - 140
VGSAVFDAMFNGGMATTSTEIELPDVEPAAFLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCV    141 - 210
EFLKKNLRADNAFMLLTQARLFDEPQLASLCLENIDKNTADAITAEGFTDIDLDTLVAVLERDTLGIREV    211 - 280
RLFNAVVRWSEAECQRQQLQVTPENRRKVLGKALGLIRFPLMTIEEFAAGPAQSGILVDREVVSLFLHFT    281 - 350
VNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQV    351 - 420
NIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHES    421 - 490
PTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT                                       491 - 525
//

Text Mined References (19)

PMID Year Title