Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
Funding $116,728.66
PubMed Score 22.79
PubTator Score 8.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.429 0.003
tuberculosis 1.200 0.000

Synonym

Accession Q9BX68 Q5TCW3 HINT-2
Symbols HIT-17

Gene

PDB

4INC   4INI   4NJX   4NJY   4NJZ   4NK0  

Gene RIF (4)

PMID Text
23682076 Low HINT2 expression is associated with low response to therapy in endometrial cancer.
23659632 X-ray crystal structure of human HINT2 with and without bound AMP.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18653718 Hint2 is required for an optimal steroidogenic response, possibly because of a particular signalling function exerted within the mitochondria.

AA Sequence

MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILY      1 - 70
EDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKL     71 - 140
GAQSVYHLHIHVLGGRQLQWPPG                                                   141 - 163
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23682076 2013 Progesterone enhances calcitriol antitumor activity by upregulating vitamin D receptor expression and promoting apoptosis in endometrial cancer cells.
23659632 2013 Structural characterization of human histidine triad nucleotide-binding protein 2, a member of the histidine triad superfamily.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18653718 2008 Hint2 is expressed in the mitochondria of H295R cells and is involved in steroidogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16762638 2006 Hint2, a mitochondrial apoptotic sensitizer down-regulated in hepatocellular carcinoma.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...