Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.20
PubTator Score 8.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.429 2.7e-03
tuberculosis 1.200 2.4e-08

Gene RIF (6)

AA Sequence

MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILY      1 - 70
EDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKL     71 - 140
GAQSVYHLHIHVLGGRQLQWPPG                                                   141 - 163
//

Text Mined References (17)

PMID Year Title